Property Summary

NCBI Gene PubMed Count 25
PubMed Score 54.21
PubTator Score 36.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
posterior fossa group B ependymoma -1.800 3.7e-14
glioblastoma 2.200 4.5e-03
group 3 medulloblastoma 1.700 1.4e-04
pilocytic astrocytoma 1.200 1.0e-03
Breast cancer -3.400 1.0e-24
breast carcinoma -1.100 2.9e-08

Gene RIF (8)

PMID Text
24481423 Forced nuclear enrichment of CITED1 in a human WT cell line appears to enhance tumorigenicity, whereas ectopic cytosolic expression confers stem-like properties and an embryonic phenotype.
23935526 Thus deficiency of Cited1 leads to hyper-activation of Wnt signaling and an exaggerated Wnt phenotype including elevated cell death
23746764 The CITED1 expression is correlated with lymph node metastasis in patients with colorectal cancer.
22703800 CITED1 expression remains active across all disease characteristics of Wilms tumor. It is found in the nucleus & cytosol. It is not found in normal kidney.
21449767 epigenetic regulation is involved in the overexpression of CITED1 in papillary thyroid cancer
21172805 TOX3 induces transcription in neuron depending on the presence of CITED1 or phosphorylated CREB in the transcriptionally active complex.
17710162 CITED1 could play a role in Wilms' tumor initiation and pathogenesis.
16864582 CITED1 functions as a cell cycle-dependent transcriptional cofactor whose activity is regulated by phosphorylation

AA Sequence

MPTTSRPALDVKGGTSPAKEDANQEMSSVAYSNLAVKDRKAVAILHYPGVASNGTKASGAPTSSSGSPIG      1 - 70
SPTTTPPTKPPSFNLHPAPHLLASMHLQKLNSQYQGMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSA     71 - 140
GAQSPAIIDSDPVDEEVLMSLVVELGLDRANELPELWLGQNEFDFTADFPSSC                     141 - 193
//

Text Mined References (30)

PMID Year Title
24481423 2014 CITED1 confers stemness to Wilms tumor and enhances tumorigenic responses when enriched in the nucleus.
23935526 2013 Cited1 deficiency suppresses intestinal tumorigenesis.
23746764 2013 Predicting lymph node metastasis in early colorectal cancer using the CITED1 expression.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22703800 2012 SIX2 and CITED1, markers of nephronic progenitor self-renewal, remain active in primitive elements of Wilms' tumor.
21449767 2011 Aberrant promoter methylation in overexpression of CITED1 in papillary thyroid cancer.
21172805 2011 TOX3 is a neuronal survival factor that induces transcription depending on the presence of CITED1 or phosphorylated CREB in the transcriptionally active complex.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17938205 2007 An EGR2/CITED1 transcription factor complex and the 14-3-3sigma tumor suppressor are involved in regulating ErbB2 expression in a transgenic-mouse model of human breast cancer.
17710162 2007 CITED1 expression in Wilms' tumor and embryonic kidney.
17336183 2007 Wilms' tumorigenesis is altered by misexpression of the transcriptional co-activator, CITED1.
16864582 2006 The transcriptional activity of CITED1 is regulated by phosphorylation in a cell cycle-dependent manner.
15843474 2005 Cited1 is a bifunctional transcriptional cofactor that regulates early nephronic patterning.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11744733 2002 Human CREB-binding protein/p300-interacting transactivator with ED-rich tail (CITED) 4, a new member of the CITED family, functions as a co-activator for transcription factor AP-2.
11581164 2001 Selective coactivation of estrogen-dependent transcription by CITED1 CBP/p300-binding protein.
11443112 2001 Identification and characterization of RRM-containing coactivator activator (CoAA) as TRBP-interacting protein, and its splice variant as a coactivator modulator (CoAM).
11310794 2001 Aberrant expression of MSG1 transcriptional activator in human malignant melanoma in vivo.
10722728 2000 The MSG1 non-DNA-binding transactivator binds to the p300/CBP coactivators, enhancing their functional link to the Smad transcription factors.
10644012 1999 Expression of genes for microphthalmia isoforms, Pax3 and MSG1, in human melanomas.
10327051 1999 The N-terminal transactivation domain of ATF2 is a target for the co-operative activation of the c-jun promoter by p300 and 12S E1A.
9721210 1998 MSG1 (melanocyte-specific gene 1): mapping to chromosome Xq13.1, genomic organization, and promoter analysis.
9707553 1998 Transcriptional activating activity of Smad4: roles of SMAD hetero-oligomerization and enhancement by an associating transactivator.
9683535 1998 Regulation of expression of MSG1 melanocyte-specific nuclear protein in human melanocytes and melanoma cells.
9434189 1997 MSG1 and its related protein MRG1 share a transcription activating domain.
8901575 1996 msg1, a novel melanocyte-specific gene, encodes a nuclear protein and is associated with pigmentation.