Property Summary

NCBI Gene PubMed Count 29
PubMed Score 36.25
PubTator Score 22.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.600 8.4e-03
ependymoma -1.500 2.0e-02
oligodendroglioma -1.200 2.2e-02
osteosarcoma -2.904 2.8e-06
glioblastoma -1.300 1.1e-04
ovarian cancer 2.400 6.9e-05
pituitary cancer 1.100 4.8e-07

 OMIM Phenotype (1)

Pathway (1)

Gene RIF (13)

PMID Text
26621032 NAF-1 is a major player in the metabolic regulation of breast cancer cells.
26565812 High CISD2 expression was significantly associated with gastric cancer.
26154755 The findings suggested that CISD2 haplotype-tagging single nucleotide polymorphisms are not associated with Alzheimer's disease risk.
25371195 A novel CISD2 mutation is associated with wolfram syndrome 2.
25134919 Studied the expression pattern and clinicopathological significance of CISD2 in patients with early-stage cervical cancer.
24706857 provides the first structural information, to our knowledge, for future targeting of the NAF-1-Bcl-2 complex in the regulation of apoptosis/autophagy in cancer biology
23959881 Data show that the protein levels of NAF-1 (CISD2) and mNT (CISD1) are elevated in human epithelial breast cancer cells.
23717386 NAF-1 as a previously unidentified cell target of anti-diabetes thiazolidinedione drugs.
20649540 CISD2 has a role in lifespan control and disease [review]
20010695 NAF-1 is a BCL-2-associated co-factor that targets BCL-2 for antagonism of the autophagy pathway at the endoplasmic reticulum.
19580816 The authors show that Miner1 is a homodimer harboring two redox-active 2Fe-2S clusters, indicating for the first time an association of a redox-active FeS protein with Wolfram Syndrome 2.
17846994 A single missense mutation was identified in a novel, highly conserved zinc-finger gene, ZCD2, in three consanguineous families of Jordanian descent with Wolfram syndrome (WFS).
14724730 Novel mutation, new phenotypic variant with no diabetes insipidus, presence of peptic ulcer disease, platelet aggregation defect

AA Sequence

MVLESVARIVKVQLPAYLKRLPVPESITGFARLTVSEWLRLLPFLGVLALLGYLAVRPFLPKKKQQKDSL      1 - 70
INLKIQKENPKVVNEINIEDLCLTKAAYCRCWRSKTFPACDGSHNKHNELTGDNVGPLILKKKEV          71 - 135
//

Text Mined References (34)

PMID Year Title
26621032 2016 Activation of apoptosis in NAF-1-deficient human epithelial breast cancer cells.
26565812 2016 Overexpressed CISD2 has prognostic value in human gastric cancer and promotes gastric cancer cell proliferation and tumorigenesis via AKT signaling pathway.
26154755 2015 Sequence variants of the aging gene CISD2 and the risk for Alzheimer's disease.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25371195 2015 Wolfram syndrome 2: a novel CISD2 mutation identified in Italian siblings.
25134919 2014 CISD2 expression is a novel marker correlating with pelvic lymph node metastasis and prognosis in patients with early-stage cervical cancer.
24706857 2014 Integrated strategy reveals the protein interface between cancer targets Bcl-2 and NAF-1.
24159190 2014 Genome-wide association study on dimethylarginines reveals novel AGXT2 variants associated with heart rate variability but not with overall mortality.
23959881 2013 NAF-1 and mitoNEET are central to human breast cancer proliferation by maintaining mitochondrial homeostasis and promoting tumor growth.
23717386 2013 Nutrient-deprivation autophagy factor-1 (NAF-1): biochemical properties of a novel cellular target for anti-diabetic drugs.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20649540 2010 A role for the CISD2 gene in lifespan control and human disease.
20010695 2010 Antagonism of Beclin 1-dependent autophagy by BCL-2 at the endoplasmic reticulum requires NAF-1.
19946888 2010 Defining the membrane proteome of NK cells.
19580816 2009 Crystal structure of Miner1: The redox-active 2Fe-2S protein causative in Wolfram Syndrome 2.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17846994 2007 A homozygous mutation in a novel zinc-finger protein, ERIS, is responsible for Wolfram syndrome 2.
17584744 2007 The outer mitochondrial membrane protein mitoNEET contains a novel redox-active 2Fe-2S cluster.
17376863 2007 MitoNEET is an iron-containing outer mitochondrial membrane protein that regulates oxidative capacity.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14724730 2003 Wolfram syndrome: phenotype and novel mutation in two Taiwanese siblings.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11317648 2001 Bleeding tendency in Wolfram syndrome: a newly identified feature with phenotype genotype correlation.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10739754 2000 Homozygosity mapping identifies an additional locus for Wolfram syndrome on chromosome 4q.