Property Summary

NCBI Gene PubMed Count 37
PubMed Score 54.59
PubTator Score 55.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
ependymoma -1.300 2.2e-06
glioblastoma -1.500 1.4e-03
astrocytoma -1.700 1.9e-03
atypical teratoid / rhabdoid tumor -1.800 4.5e-06
medulloblastoma -1.300 7.1e-04
medulloblastoma, large-cell -1.200 1.5e-03
primitive neuroectodermal tumor -1.100 3.1e-03
autosomal dominant Emery-Dreifuss muscul... -1.074 1.4e-02
lung cancer 2.000 1.1e-04
Breast cancer 3.100 2.6e-02
adult high grade glioma -1.700 6.5e-05
Polycystic Ovary Syndrome 1.001 2.2e-02
lung carcinoma 1.200 1.4e-18
Pick disease -1.100 3.0e-03
acute myeloid leukemia -1.300 9.6e-03

Gene RIF (31)

PMID Text
26887944 the redox-sensing function of mNT is a key component of the cellular adaptive response to help stress-sensitive Fe-S proteins recover from oxidative injury.
26778000 Our results confirm the observation that mitoNEET is important in transferring the iron sulfur clusters to the cytosolic aconitase in living cells and the His-87 ligand in mitoNEET plays important role in this process.
26692580 A possible role of CISD1 in obesity-associated dysfunctional adipogenesis in human visceral adipose tissue.
25645953 Glutathione reductase reduces mitochondrial protein mitoNEET [2Fe-2S] clusters.
25448035 Studies indicate that NEET proteins are associated with diseases including cancer and diabetes.
25168891 SNPs in three genes CYP26B1 rs2241057, CISD1 rs2251039, rs2590370, and TBX1 rs4819522 were involved in six potential pathways to influence serum prostate-specific antigen levels.
25012650 MitoNEET governs a novel trafficking pathway to rebuild an Fe-S cluster into cytosolic aconitase/IRP1.
24814435 In this review, we evaluate the current understanding regarding how mitoNEET regulates cellular bioenergetics as well as the structural requirements for drug compound association with mitoNEET
24403080 pioglitazone may modulate the function of mitoNEET by blocking the thiol-mediated reduction of [2Fe-2S] clusters in the protein.
24295216 The MitoNEET forms a covalent complex with GDH1 through disulfide bond formation and acts as an activator.
23959881 Data show that the protein levels of NAF-1 (CISD2) and mNT (CISD1) are elevated in human epithelial breast cancer cells.
23271805 a loop (L2) 20 A away from the metal center exerts allosteric control over the cluster binding domain and regulates multiple properties of the metal center. Mutagenesis of L2 results in significant shifts in the redox potential of the [2Fe-2S] cluster.
22351774 NADPH can regulate both mitoNEET [2Fe-2S] cluster levels in the cell as well as the ability of the protein to transfer [2Fe-2S] clusters to cytosolic or mitochondrial acceptors.
21788481 These findings suggest a likely role for mNT in [2Fe-2S] and/or iron transfer to acceptor proteins.
21636891 crystal structure of H87C mitoNEET was determined to 1.7 A resolution (R factor = 18%) to investigate the structural basis of the changes in the properties of the 2Fe-2S cluster
21591687 The iron-sulfur cluster-containing protein mitoNEET interacts with two potentially redox active substances at the surface of mitochondria; mitoNEET forms complexes with resveratrol-3-sulfate, a primary metabolite of the natural product resveratrol.
21531159 Results describe the discovery of potential mitoNEET ligand binding sites and novel ligands, and suggests the possibility for detailed structural studies of mitoNEET-ligand complexes.
21402934 Results describe the folding landscape of mitoNEET, and uncover communication between distal regions of the protein.
20932062 Reduced nicotinamide adenine dinucleotide phosphate (NADPH) can bind to homodimeric mitoNEET, influencing the stability of the [2Fe-2S] cluster that is bound within a loop region (Y71-H87) in each subunit.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20099820 We use electron paramagnetic resonance spectroscopy to investigate the [2Fe-2S]cluster in mitoNEET.
19574633 There is considerable flexibility in the position of the cytoplasmic tethering arms, resulting in two different conformations in the crystal structure of mitoNEET.
19388667 The physiologically relevant acid ionization constant (pKa) of histidine residues makes histidine87 a likely candidate for modulating the lability of the metal cluster in mitoNEET.
19214198 Application of HIV-1 Tat transmembrane transport peptide to cells induces PKN1 gene and slightly represses two genes, ZCD1 and BSG
18047834 A CISD1-GFP chimera was found to be located into mitochondria.
17905743 X-ray crystallographic studies show that mitoNEET dimer may interact with other proteins via the surface residues in close proximity to the [2Fe-2S] cluster
17766440 biophysical properties of mitoNEET suggest that it may participate in a redox-sensitive signaling and/or in Fe-S cluster transfer
17766439 Crystal structure of mitoNEET reveals distinct groups of iron sulfur proteins.
17584744 Spectroscopic studies show that the 2Fe-2S cluster is coordinated by Cys-3 and His-1. The His ligand is shown to be involved in the observed pH lability of the cluster, indicating that loss of this ligand via protonation triggered release of the cluster.
17376863 mito- NEET is an important iron-containing protein involved in the control of maximal mitochondrial respiratory rates
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAV      1 - 70
YCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET                                     71 - 108
//

Text Mined References (44)

PMID Year Title
26887944 2016 Redox Control of the Human Iron-Sulfur Repair Protein MitoNEET Activity via Its Iron-Sulfur Cluster.
26778000 2016 His-87 ligand in mitoNEET is crucial for the transfer of iron sulfur clusters from mitochondria to cytosolic aconitase.
26692580 2016 CISD1 in association with obesity-associated dysfunctional adipogenesis in human visceral adipose tissue.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25645953 2015 Reduction of mitochondrial protein mitoNEET [2Fe-2S] clusters by human glutathione reductase.
25621951 2015 USP30 and parkin homeostatically regulate atypical ubiquitin chains on mitochondria.
25448035 2015 Structure-function analysis of NEET proteins uncovers their role as key regulators of iron and ROS homeostasis in health and disease.
25168891 2014 Pathway analysis of genome-wide association study on serum prostate-specific antigen levels.
25012650 2014 The diabetes drug target MitoNEET governs a novel trafficking pathway to rebuild an Fe-S cluster into cytosolic aconitase/iron regulatory protein 1.
24814435 2014 mitoNEET as a novel drug target for mitochondrial dysfunction.
24403080 2014 Redox control of human mitochondrial outer membrane protein MitoNEET [2Fe-2S] clusters by biological thiols and hydrogen peroxide.
24295216 2013 Identification of disulfide bond formation between MitoNEET and glutamate dehydrogenase 1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23959881 2013 NAF-1 and mitoNEET are central to human breast cancer proliferation by maintaining mitochondrial homeostasis and promoting tumor growth.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23271805 2013 Allosteric control in a metalloprotein dramatically alters function.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22351774 2012 NADPH inhibits [2Fe-2S] cluster protein transfer from diabetes drug target MitoNEET to an apo-acceptor protein.
21788481 2011 Facile transfer of [2Fe-2S] clusters from the diabetes drug target mitoNEET to an apo-acceptor protein.
21636891 2011 Mutation of the His ligand in mitoNEET stabilizes the 2Fe-2S cluster despite conformational heterogeneity in the ligand environment.
21591687 2011 Complexes of the outer mitochondrial membrane protein mitoNEET with resveratrol-3-sulfate.
21531159 2011 Novel ligands that target the mitochondrial membrane protein mitoNEET.
21402934 2011 Interdomain communication revealed in the diabetes drug target mitoNEET.
21269460 2011 Initial characterization of the human central proteome.
20932062 2010 Binding of reduced nicotinamide adenine dinucleotide phosphate destabilizes the iron?sulfur clusters of human mitoNEET.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20833797 2011 Phosphoproteome analysis of functional mitochondria isolated from resting human muscle reveals extensive phosphorylation of inner membrane protein complexes and enzymes.
20099820 2010 Binding of histidine in the (Cys)3(His)1-coordinated [2Fe-2S] cluster of human mitoNEET.
19580816 2009 Crystal structure of Miner1: The redox-active 2Fe-2S protein causative in Wolfram Syndrome 2.
19574633 2009 The novel 2Fe-2S outer mitochondrial protein mitoNEET displays conformational flexibility in its N-terminal cytoplasmic tethering domain.
19388667 2009 Resonance Raman studies of the (His)(Cys)3 2Fe-2S cluster of MitoNEET: comparison to the (Cys)4 mutant and implications of the effects of pH on the labile metal center.
18047834 2008 CISD1 codifies a mitochondrial protein upregulated by the CFTR channel.
17905743 2007 Crystallographic studies of human MitoNEET.
17766440 2007 MitoNEET is a uniquely folded 2Fe 2S outer mitochondrial membrane protein stabilized by pioglitazone.
17766439 2007 Crystal structure of human mitoNEET reveals distinct groups of iron sulfur proteins.
17584744 2007 The outer mitochondrial membrane protein mitoNEET contains a novel redox-active 2Fe-2S cluster.
17376863 2007 MitoNEET is an iron-containing outer mitochondrial membrane protein that regulates oxidative capacity.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.