Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 5.4e-08
Disease Target Count Z-score Confidence
Peutz-Jeghers syndrome 23 4.101 2.1

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.721 5.4e-08

Synonym

Accession Q8TBR5
Symbols C19orf23

 Compartment GO Term (0)

AA Sequence

MAPEVIRQDFQAGEVAFRRTGYLRGRSVLTQTKHSLAGNGRHPVALRTRLGSLALGAVPTWTKLWAQSTT      1 - 70
WQTRNHTRTGHAYPRFTRPSFPSCNRNGKRRKLRLGLPY                                    71 - 109
//

Text Mined References (4)

PMID Year Title
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.