Property Summary

NCBI Gene PubMed Count 34
PubMed Score 133.00
PubTator Score 33.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
hepatocellular carcinoma 1.100 2.7e-04
interstitial lung disease 1.600 8.1e-03
Multiple myeloma 2.016 1.3e-04
astrocytic glioma 1.700 1.3e-02
ependymoma 2.600 1.3e-02
oligodendroglioma 2.000 9.4e-04
psoriasis -1.400 8.6e-04
osteosarcoma -2.712 1.4e-05
tuberculosis and treatment for 6 months -1.400 3.5e-06
primary pancreatic ductal adenocarcinoma -1.603 2.6e-03
non-small cell lung cancer -1.534 8.0e-19
intraductal papillary-mucinous adenoma (... 1.100 2.1e-03
intraductal papillary-mucinous carcinoma... -1.300 5.1e-03
intraductal papillary-mucinous neoplasm ... -1.300 9.2e-03
group 4 medulloblastoma 1.100 3.6e-04
subependymal giant cell astrocytoma -1.273 4.4e-02
lung adenocarcinoma -1.600 8.0e-13
invasive ductal carcinoma -1.154 5.1e-06
inflammatory breast cancer -2.100 4.6e-05
Alzheimer's disease -1.900 3.0e-02
Pick disease -2.900 3.3e-08
progressive supranuclear palsy -2.400 7.0e-03
ovarian cancer -2.600 4.5e-08
pancreatic cancer -1.400 1.1e-02
dermatomyositis 1.600 2.0e-04

Gene RIF (14)

PMID Text
26673712 CIRP protein regulates telomerase activity in a temperature-dependent manner by regulating the level of TERT mRNAs.
26361390 Study shows that CIRP elevated plasma concentration is significantly associated with poor prognosis among patients with sepsis. Therefore, CIRP is a potential predictor of sepsis prognosis.
26188505 CIRP inhibits DNA damage-induced apoptosis by regulating p53 protein.CIRP suppresses p53 upregulation during apoptosis.CIRP regulates the expression of genes involved in apoptosis.
25934796 The expression of CIRP in pituitary adenoma is closely related with tumor proliferation and invasion, and its significantly elevated expression level indicates post-op recurrence.
25187386 Cirp promotes the development of intestinal inflammation and colorectal tumors through regulating apoptosis and production of TNFalpha and IL23 in inflammatory cells.
25027624 High levels of CIRP protein expression was associated with a short survival rate in oral squamous cell carcinoma patients.
24097189 report increased levels of cold-inducible RNA-binding protein (CIRP) in the blood of individuals admitted to the surgical intensive care unit with hemorrhagic shock
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of cold inducible RNA binding protein (CIRBP) expression by HIV-1 Vpr in Vpr transduced macrophages
23437386 CIRBP regulates the expression of interleukin-1beta in an NF-kappaB-dependent fashion.
23437386 CIRBP contributes to ultraviolet light- and lipopolysaccharide-induced expression of IL1beta by regulating NFkappaB activity.
19277990 pharmacological modulation of RBM3 and CIRBP may represent novel therapeutic approaches for prostate cancer.
19158277 CIRP enhanced extracellular signal-regulated kinase 1 and 2 (ERK1/2) phosphorylation, and treatment with an MEK inhibitor decreased the proliferation caused by CIRP.
15075239 RBM3 and CIRP are adaptatively expressed in response to hypoxia by a mechanism that involves neither HIF-1 nor mitochondria
12819390 results suggest that cold inducible RNA binding protein may participate in the cell cycle regulation of normal endometrium and the loss of its expression may be involved in endometrial carcinogenesis

AA Sequence

MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGK      1 - 70
SVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRD     71 - 140
YYSSRSQSGGYSDRSSGGSYRDSYDSYATHNE                                          141 - 172
//

Text Mined References (39)

PMID Year Title
26673712 2016 Cold-inducible RNA-binding protein CIRP/hnRNP A18 regulates telomerase activity in a temperature-dependent manner.
26361390 2015 The Cold-Inducible RNA-Binding Protein (CIRP) Level in Peripheral Blood Predicts Sepsis Outcome.
26188505 2015 Cold-inducible RNA-binding protein, CIRP, inhibits DNA damage-induced apoptosis by regulating p53.
25934796 2015 Expression of cold-inducible RNA-binding protein (CIRP) in pituitary adenoma and its relationships with tumor recurrence.
25416956 2014 A proteome-scale map of the human interactome network.
25187386 2014 Stress response protein cirp links inflammation and tumorigenesis in colitis-associated cancer.
25027624 2014 Protein overexpression of CIRP and TLR4 in oral squamous cell carcinoma: an immunohistochemical and clinical correlation analysis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24097189 2013 Cold-inducible RNA-binding protein (CIRP) triggers inflammatory responses in hemorrhagic shock and sepsis.
23437386 2013 NF-?B-dependent role for cold-inducible RNA binding protein in regulating interleukin 1?.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19277990 2009 Down-regulating cold shock protein genes impairs cancer cell survival and enhances chemosensitivity.
19158277 2009 Cold-inducible RNA-binding protein bypasses replicative senescence in primary cells through extracellular signal-regulated kinase 1 and 2 activation.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18482256 2009 Protein microarray analysis identifies human cellular prion protein interactors.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16791210 2006 Dynamic proteomics in individual human cells uncovers widespread cell-cycle dependence of nuclear proteins.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16513844 2006 Post-transcriptional regulation of thioredoxin by the stress inducible heterogenous ribonucleoprotein A18.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15075239 2004 Oxygen-regulated expression of the RNA-binding proteins RBM3 and CIRP by a HIF-1-independent mechanism.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12819390 2003 Expression of cold-inducible RNA-binding protein in the normal endometrium, endometrial hyperplasia, and endometrial carcinoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11850402 2002 PABP1 identified as an arginine methyltransferase substrate using high-density protein arrays.
11574538 2001 The UV-inducible RNA-binding protein A18 (A18 hnRNP) plays a protective role in the genotoxic stress response.
9434172 1997 Cloning and characterization of human CIRP (cold-inducible RNA-binding protein) cDNA and chromosomal assignment of the gene.
9422546 1998 Decreased expression of cold-inducible RNA-binding protein (CIRP) in male germ cells at elevated temperature.
9334257 1997 Identification of several human homologs of hamster DNA damage-inducible transcripts. Cloning and characterization of a novel UV-inducible cDNA that codes for a putative RNA-binding protein.
9151692 1997 A glycine-rich RNA-binding protein mediating cold-inducible suppression of mammalian cell growth.