Property Summary

NCBI Gene PubMed Count 15
PubMed Score 2.08
PubTator Score 207.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6685 3.6e-05
osteosarcoma 7933 1.6e-04

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -2.000 3.6e-05
osteosarcoma -1.201 1.6e-04

 GWAS Trait (1)

Protein-protein Interaction (9)

Gene RIF (1)

PMID Text
15652350 identified as a PAP-1 binding protein and as a splicing factor

AA Sequence

MGKSFANFMCKKDFHPASKSNIKKVWMAEQKISYDKKKQEELMQQYLKEQESYDNRLLMGDERVKNGLNF      1 - 70
MYEAPPGAKKENKEKEETEGETEYKFEWQKGAPREKYAKDDMNIRDQPFGIQVRNVRCIKCHKWGHVNTD     71 - 140
RECPLFGLSGINASSVPTDGSGPSMHPSELIAEMRNSGFALKRNVLGRNLTANDPSQEYVASEGEEDPEV    141 - 210
EFLKSLTTKQKQKLLRKLDRLEKKKKKKDRKKKKFQKSRSKHKKHKSSSSSSSSSSSSSSTETSESSSES    211 - 280
ESNNKEKKIQRKKRKKNKCSGHNNSDSEEKDKSKKRKLHEELSSSHHNREKAKEKPRFLKHESSREDSKW    281 - 350
SHSDSDKKSRTHKHSPEKRGSERKEGSSRSHGREERSRRSRSRSPGSYKQRETRKRAQRNPGEEQSRRND    351 - 420
SRSHGTDLYRGEKMYREHPGGTHTKVTQRE                                            421 - 450
//

Text Mined References (21)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20873783 2010 Characterization of hNek6 interactome reveals an important role for its short N-terminal domain and colocalization with proteins at the centrosome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19409814 2009 NKAP is a transcriptional repressor of notch signaling and is required for T cell development.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18663143 2008 Slug is a direct Notch target required for initiation of cardiac cushion cellularization.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15652350 2005 CIR, a corepressor of CBF1, binds to PAP-1 and effects alternative splicing.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11591653 2001 Protein-protein interaction panel using mouse full-length cDNAs.
11509665 2001 Nuclear localization of CBF1 is regulated by interactions with the SMRT corepressor complex.
11222720 2001 Epstein-Barr virus BamHi-a rightward transcript-encoded RPMS protein interacts with the CBF1-associated corepressor CIR to negatively regulate the activity of EBNA2 and NotchIC.
10644367 2000 A role for SKIP in EBNA2 activation of CBF1-repressed promoters.
9874765 1999 CIR, a corepressor linking the DNA binding factor CBF1 to the histone deacetylase complex.
3031469 1987 Analysis of mutation in human cells by using an Epstein-Barr virus shuttle system.