Property Summary

NCBI Gene PubMed Count 11
PubMed Score 59.35
PubTator Score 30.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (3)

Disease log2 FC p
astrocytic glioma -1.200 4.9e-02
atypical teratoid / rhabdoid tumor -1.300 8.4e-09
glioblastoma -1.200 1.7e-04

Protein-protein Interaction (6)

Gene RIF (3)

PMID Text
21628470 NS5B delays cells in S phase through interaction with CINP and relocalization of the protein from the nucleus to the cytoplasm
19889979 CINP interacts with ATR-interacting protein and regulates ATR-dependent signaling, resistance to replication stress, and G2 checkpoint integrity.
16082200 CINP is part of the Cdc7-dependent mechanism of origin firing and a functional and physical link between Cdk2 and Cdc7 complexes at the origins

AA Sequence

MEAKTLGTVTPRKPVLSVSARKIKDNAADWHNLILKWETLNDAGFTTANNIANLKISLLNKDKIELDSSS      1 - 70
PASKENEEKVCLEYNEELEKLCEELQATLDGLTKIQVKMEKLSSTTKGICELENYHYGEESKRPPLFHTW     71 - 140
PTTHFYEVSHKLLEMYRKELLLKRTVAKELAHTGDPDLTLSYLSMWLHQPYVESDSRLHLESMLLETGHR    141 - 210
AL                                                                        211 - 212
//

Text Mined References (19)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21628470 2011 Hepatitis C virus NS5B protein delays s phase progression in human hepatocyte-derived cells by relocalizing cyclin-dependent kinase 2-interacting protein (CINP).
21269460 2011 Initial characterization of the human central proteome.
21131973 2011 CEP152 is a genome maintenance protein disrupted in Seckel syndrome.
19889979 2009 Functional genomic screens identify CINP as a genome maintenance protein.
19647519 2009 A genome-wide siRNA screen reveals diverse cellular processes and pathways that mediate genome stability.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17273735 2007 Modification of gene expression by melatonin in UVB-irradiated HaCaT keratinocyte cell lines using a cDNA microarray.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16082200 2005 A novel Cdk2 interactor is phosphorylated by Cdc7 and associates with components of the replication complexes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.