Property Summary

NCBI Gene PubMed Count 23
PubMed Score 31.92
PubTator Score 33.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
osteosarcoma 2.678 1.3e-04
medulloblastoma, large-cell 1.300 8.1e-06
Duchenne muscular dystrophy 1.671 1.4e-10
autosomal dominant Emery-Dreifuss muscul... 1.423 1.9e-03
limb girdle muscular dystrophy 2A 1.370 5.6e-06
Becker muscular dystrophy 1.401 6.9e-05
Atopic dermatitis -1.900 9.1e-04
intraductal papillary-mucinous adenoma (... -1.600 2.6e-04
intraductal papillary-mucinous carcinoma... -1.700 5.3e-04
intraductal papillary-mucinous neoplasm ... -1.600 5.8e-03
colon cancer -2.600 9.7e-03
fibroadenoma -1.600 2.1e-02
diabetes mellitus -1.300 1.6e-03
lung adenocarcinoma 1.200 9.0e-06
adult high grade glioma 1.200 1.2e-03
psoriasis -1.700 9.2e-36
spina bifida -1.509 4.7e-02
Breast cancer 2.000 5.6e-06
ovarian cancer 3.200 3.2e-06
facioscapulohumeral dystrophy 2.100 8.1e-03

Gene RIF (8)

PMID Text
22107760 CILP is involved in the etiology of intervertebral disc degeneration among young adults.
20724643 The researchers found that the single nucleotide polymorphism (1184T/C) of the CILP gene is associated an increased risk of lumbar disc degeneration in male athletes.
20724643 Observational study of gene-disease association. (HuGE Navigator)
19569011 the CILP gene 1184T/C polymorphism is a significant risk factor for lumbar disc degeneration occurrence in Japanese collegiate judo athletes
17220213 SNP analysis suggested that the CILP gene is not a major risk factor for symptoms of lumbar disc disease in Finnish or Chinese populations.
16453284 Observational study of gene-disease association. (HuGE Navigator)
16413503 These observations, together with the finding that CILP protein binds and inhibits TGF-beta1, suggest that CILP and TGF-beta1 may form a functional feedback loop that controls chondrocyte metabolism.
15864306 CILP regulates TGF-beta signaling and that this regulation has a crucial role in the etiology and pathogenesis of LDD.

AA Sequence

MVGTKAWVFSFLVLEVTSVLGRQTMLTQSVRRVQPGKKNPSIFAKPADTLESPGEWTTWFNIDYPGGKGD      1 - 70
YERLDAIRFYYGDRVCARPLRLEARTTDWTPAGSTGQVVHGSPREGFWCLNREQRPGQNCSNYTVRFLCP     71 - 140
PGSLRRDTERIWSPWSPWSKCSAACGQTGVQTRTRICLAEMVSLCSEASEEGQHCMGQDCTACDLTCPMG    141 - 210
QVNADCDACMCQDFMLHGAVSLPGGAPASGAAIYLLTKTPKLLTQTDSDGRFRIPGLCPDGKSILKITKV    211 - 280
KFAPIVLTMPKTSLKAATIKAEFVRAETPYMVMNPETKARRAGQSVSLCCKATGKPRPDKYFWYHNDTLL    281 - 350
DPSLYKHESKLVLRKLQQHQAGEYFCKAQSDAGAVKSKVAQLIVIASDETPCNPVPESYLIRLPHDCFQN    351 - 420
ATNSFYYDVGRCPVKTCAGQQDNGIRCRDAVQNCCGISKTEEREIQCSGYTLPTKVAKECSCQRCTETRS    421 - 490
IVRGRVSAADNGEPMRFGHVYMGNSRVSMTGYKGTFTLHVPQDTERLVLTFVDRLQKFVNTTKVLPFNKK    491 - 560
GSAVFHEIKMLRRKKPITLEAMETNIIPLGEVVGEDPMAELEIPSRSFYRQNGEPYIGKVKASVTFLDPR    561 - 630
NISTATAAQTDLNFINDEGDTFPLRTYGMFSVDFRDEVTSEPLNAGKVKVHLDSTQVKMPEHISTVKLWS    631 - 700
LNPDTGLWEEEGDFKFENQRRNKREDRTFLVGNLEIRERRLFNLDVPESRRCFVKVRAYRSERFLPSEQI    701 - 770
QGVVISVINLEPRTGFLSNPRAWGRFDSVITGPNGACVPAFCDDQSPDAYSAYVLASLAGEELQAVESSP    771 - 840
KFNPNAIGVPQPYLNKLNYRRTDHEDPRVKKTAFQISMAKPRPNSAEESNGPIYAFENLRACEEAPPSAA    841 - 910
HFRFYQIEGDRYDYNTVPFNEDDPMSWTEDYLAWWPKPMEFRACYIKVKIVGPLEVNVRSRNMGGTHRQT    911 - 980
VGKLYGIRDVRSTRDRDQPNVSAACLEFKCSGMLYDQDRVDRTLVKVIPQGSCRRASVNPMLHEYLVNHL    981 - 1050
PLAVNNDTSEYTMLAPLDPLGHNYGIYTVTDQDPRTAKEIALGRCFDGTSDGSSRIMKSNVGVALTFNCV   1051 - 1120
ERQVGRQSAFQYLQSTPAQSPAAGTVQGRVPSRRQQRASRGGQRQGGVVASLRFPRVAQQPLIN         1121 - 1184
//

Text Mined References (26)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23033978 2012 Diagnostic exome sequencing in persons with severe intellectual disability.
22107760 2011 Genetic susceptibility of intervertebral disc degeneration among young Finnish adults.
20724643 2010 Cartilage intermediate layer protein gene is associated with lumbar disc degeneration in male, but not female, collegiate athletes.
19569011 2009 The cartilage intermediate layer protein gene is associated with lumbar disc degeneration in collegiate judokas.
17220213 2007 Phenotypic and population differences in the association between CILP and lumbar disc disease.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16453284 2006 Reproducible genetic associations between candidate genes and clinical knee osteoarthritis in men and women.
16413503 2006 Transcriptional regulation of the cartilage intermediate layer protein (CILP) gene.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15864306 2005 A functional SNP in CILP, encoding cartilage intermediate layer protein, is associated with susceptibility to lumbar disc disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15378262 2005 The prevalence of autoantibodies against cartilage intermediate layer protein, YKL-39, osteopontin, and cyclic citrullinated peptide in patients with early-stage knee osteoarthritis: evidence of a variety of autoimmune processes.
14962958 2004 Characterisation of cartilage intermediate layer protein (CILP)-induced arthropathy in mice.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12746903 2003 One of two chondrocyte-expressed isoforms of cartilage intermediate-layer protein functions as an insulin-like growth factor 1 antagonist.
12483726 2002 Up-regulated expression of cartilage intermediate-layer protein and ANK in articular hyaline cartilage from patients with calcium pyrophosphate dihydrate crystal deposition disease.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11315923 2001 Implication of cartilage intermediate layer protein in cartilage destruction in subsets of patients with osteoarthritis and rheumatoid arthritis.
10601732 1999 The human CILP gene: exon/intron organization and chromosomal mapping.
10319588 1999 Genomic organization, mapping, and polymorphisms of the gene encoding human cartilage intermediate layer protein (CILP).
9722584 1998 Cloning and deduced amino acid sequence of a novel cartilage protein (CILP) identifies a proform including a nucleotide pyrophosphohydrolase.
9722583 1998 A novel cartilage protein (CILP) present in the mid-zone of human articular cartilage increases with age.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.