Property Summary

NCBI Gene PubMed Count 27
PubMed Score 65.38
PubTator Score 37.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (8)

Disease log2 FC p
Atopic dermatitis -1.500 3.9e-02
breast carcinoma -2.200 1.3e-02
ductal carcinoma in situ -4.100 3.1e-04
ependymoma -1.100 5.1e-03
fibroadenoma -3.800 1.4e-02
invasive ductal carcinoma -4.700 9.8e-04
oligodendroglioma -1.100 2.3e-03
psoriasis -1.300 3.0e-02

Gene RIF (24)

AA Sequence

MEAARDYAGALIRPLTFMGSQTKRVLFTPLMHPARPFRVSNHDRSSRRGVMASSLQELISKTLDALVIAT      1 - 70
GLVTLVLEEDGTVVDTEEFFQTLGDNTHFMILEKGQKWMPGSQHVPTCSPPKRSGIARVTFDLYRLNPKD     71 - 140
FIGCLNVKATMYEMYSVSYDIRCTGLKGLLRSLLRFLSYSAQVTGQFLIYLGTYMLRVLDDKEERPSLRS    141 - 210
QAKGRFTCG                                                                 211 - 219
//

Text Mined References (28)

PMID Year Title