Property Summary

NCBI Gene PubMed Count 34
PubMed Score 67.62
PubTator Score 44.34

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 2.5e-04

Gene RIF (24)

PMID Text
26794043 analysis of homozygous deletions of 19q13.2 and CIC in neuroblastoma
26735859 Report CIC genetic alterations in angiosarcomas.
26685084 CIC-rearranged sarcomas are distinct from Ewing sarcomas clinically, morphologically, and immunohistochemically, and they should be considered a separate entity rather than being grouped within the same family of tumors.
26545048 With the advent of large-scale genome sequencing technology, molecular genetic alterations in CIC promoter have now been identified in the majority of oligodendrogliomas
26124181 miR-93/miR-106b/miR-375-CIC-CRABP1 is a novel key regulatory axis in prostate cancer progression
26017892 CIC mutations result in protein inactivation and poorer outcome in patients with a 1p19q codeleted glioma.
25277207 Our study showed for the first time a cooperative reduction in clonogenicity in cells co-expressing IDH1-R132H and mutant CIC proteins
25007147 Case Report: CIC-FOXO4 fusion sarcoma is a new type of Ewing-like sarcoma that has a specific genetic signature.
24897389 Downregulation of CIC protein levels was not associated with ETV1 or pMEK1/2 expression, KIT and PDGFRA mutations, copy number variations (CNV) of 19q13, and clinical factors.
24723486 The distinct gene signature and immunoprofile of CIC-DUX4 sarcomas suggest a distinct pathogenesis from Ewing sarcoma.
24197863 It is a supportive diagnostic marker for oligodendroglial tumors with the 1p/19q co-deletion.
24086756 CIC acts as a tumor suppressor in these tumors, whereas FUBP1 might play only a minor role
24030748 We conclude that absent CIC and FUBP1 expressions are potential markers of shorter time to recurrence in oligodendroglial tumors.
23887164 CIC-DUX4 sarcoma represents a novel translocation-associated sarcoma with distinctive histopathologic features and rapid disease progression.
22869205 Analysis allowed us to define two highly recurrent genetic signatures in gliomas: IDH1/ATRX (I-A) and IDH1/CIC/FUBP1 (I-CF).
22588899 Found CIC and FUBP1 mutations in oligodendrogliomas and demonstrate the presence of these mutations in oligoastrocytomas.
22072542 Our detailed study of genetic aberrations in oligodendroglioma suggests a functional interaction between CIC mutation, IDH1/2 mutation, and 1p/19q co-deletion
21817013 CIC gene was mutated in 6 oligodendrogliomas and FUBP1 gene was mutated in 2; 27 additional oligodendrogliomas showed 12 and 3 more tumors with mutations of CIC and FUBP1; results suggest role of these genes in biology and pathology of oligodendrocytes
21087211 human capicua represses mRNA expression for PEA3 (polyoma enhancer activator 3) Ets transcription factors ETV1, ETV4 and ETV5
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19837261 fusion transcripts involving CIC (19q13) and DUX4 (4q35) were confirmed to be present in both primitive round cell sarcomas, further defining the breakpoints seen by genomic analysis.
15981098 Medulloblastomas exhibited the highest level of CIC expression, although the level of expression varied between different medulloblastoma subtypes. Expression was most common in tumors of the CNS in general.
12393275 Results describe the identification and characterization of a new gene, Cic, in both human and mouse genomes, that is implicated in granule cell development.

AA Sequence

MYSAHRPLMPASSAASRGLGMFVWTNVEPRSVAVFPWHSLVPFLAPSQPDPSVQPSEAQQPASHPVASNQ      1 - 70
SKEPAESAAVAHERPPGGTGSADPERPPGATCPESPGPGPPHPLGVVESGKGPPPTTEEEASGPPGEPRL     71 - 140
DSETESDHDDAFLSIMSPEIQLPLPPGKRRTQSLSALPKERDSSSEKDGRSPNKREKDHIRRPMNAFMIF    141 - 210
SKRHRALVHQRHPNQDNRTVSKILGEWWYALGPKEKQKYHDLAFQVKEAHFKAHPDWKWCNKDRKKSSSE    211 - 280
AKPTSLGLAGGHKETRERSMSETGTAAAPGVSSELLSVAAQTLLSSDTKAPGSSSCGAERLHTVGGPGSA    281 - 350
RPRAFSHSGVHSLDGGEVDSQALQELTQMVSGPASYSGPKPSTQYGAPGPFAAPGEGGALAATGRPPLLP    351 - 420
TRASRSQRAASEDMTSDEERMVICEEEGDDDVIADDGFGTTDIDLKCKERVTDSESGDSSGEDPEGNKGF    421 - 490
GRKVFSPVIRSSFTHCRPPLDPEPPGPPDPPVAFGKGYGSAPSSSASSPASSSASAATSFSLGSGTFKAQ    491 - 560
ESGQGSTAGPLRPPPPGAGGPATPSKATRFLPMDPATFRRKRPESVGGLEPPGPSVIAAPPSGGGNILQT    561 - 630
LVLPPNKEEQEGGGARVPSAPAPSLAYGAPAAPLSRPAATMVTNVVRPVSSTPVPIASKPFPTSGRAEAS    631 - 700
PNDTAGARTEMGTGSRVPGGSPLGVSLVYSDKKSAAATSPAPHLVAGPLLGTVGKAPATVTNLLVGTPGY    701 - 770
GAPAPPAVQFIAQGAPGGGTTAGSGAGAGSGPNGPVPLGILQPGALGKAGGITQVQYILPTLPQQLQVAP    771 - 840
APAPAPGTKAAAPSGPAPTTSIRFTLPPGTSTNGKVLAATAPTPGIPILQSVPSAPPPKAQSVSPVQAPP    841 - 910
PGGSAQLLPGKVLVPLAAPSMSVRGGGAGQPLPLVSPPFSVPVQNGAQPPSKIIQLTPVPVSTPSGLVPP    911 - 980
LSPATLPGPTSQPQKVLLPSSTRITYVQSAGGHALPLGTSPASSQAGTVTSYGPTSSVALGFTSLGPSGP    981 - 1050
AFVQPLLSAGQAPLLAPGQVGVSPVPSPQLPPACAAPGGPVITAFYSGSPAPTSSAPLAQPSQAPPSLVY   1051 - 1120
TVATSTTPPAATILPKGPPAPATATPAPTSPFPSATAGSMTYSLVAPKAQRPSPKAPQKVKAAIASIPVG   1121 - 1190
SFEAGASGRPGPAPRQPLEPGPVREPTAPESELEGQPTPPAPPPLPETWTPTARSSPPLPPPAEERTSAK   1191 - 1260
GPETMASKFPSSSSDWRVPGQGLENRGEPPTPPSPAPAPAVAPGGSSESSSGRAAGDTPERKEAAGTGKK   1261 - 1330
VKVRPPPLKKTFDSVDNRVLSEVDFEERFAELPEFRPEEVLPSPTLQSLATSPRAILGSYRKKRKNSTDL   1331 - 1400
DSAPEDPTSPKRKMRRRSSCSSEPNTPKSAKCEGDIFTFDRTGTEAEDVLGELEYDKVPYSSLRRTLDQR   1401 - 1470
RALVMQLFQDHGFFPSAQATAAFQARYADIFPSKVCLQLKIREVRQKIMQAATPTEQPPGAEAPLPVPPP   1471 - 1540
TGTAAAPAPTPSPAGGPDPTSPSSDSGTAQAAPPLPPPPESGPGQPGWEGAPQPSPPPPGPSTAATGR     1541 - 1608
//

Text Mined References (44)

PMID Year Title
26794043 2016 Estimation of copy number aberrations: Comparison of exome sequencing data with SNP microarrays identifies homozygous deletions of 19q13.2 and CIC in neuroblastoma.
26735859 2016 Recurrent CIC Gene Abnormalities in Angiosarcomas: A Molecular Study of 120 Cases With Concurrent Investigation of PLCG1, KDR, MYC, and FLT4 Gene Alterations.
26685084 2016 CIC-rearranged Sarcomas: A Study of 20 Cases and Comparisons With Ewing Sarcomas.
26545048 2015 Molecular background of oligodendroglioma: 1p/19q, IDH, TERT, CIC and FUBP1.
26124181 2015 miR-93/miR-106b/miR-375-CIC-CRABP1: a novel regulatory axis in prostate cancer progression.
26017892 2015 CIC inactivating mutations identify aggressive subset of 1p19q codeleted gliomas.
25277207 2014 Mutations in CIC and IDH1 cooperatively regulate 2-hydroxyglutarate levels and cell clonogenicity.
25007147 2014 A novel CIC-FOXO4 gene fusion in undifferentiated small round cell sarcoma: a genetically distinct variant of Ewing-like sarcoma.
24950227 2014 The "grep" command but not FusionMap, FusionFinder or ChimeraScan captures the CIC-DUX4 fusion gene from whole transcriptome sequencing data on a small round cell tumor with t(4;19)(q35;q13).
24897389 2014 Downregulation of CIC does not associate with overexpression of ETV1 or MAP kinase pathway activation in gastrointestinal stromal tumors.
24723486 2014 Distinct transcriptional signature and immunoprofile of CIC-DUX4 fusion-positive round cell tumors compared to EWSR1-rearranged Ewing sarcomas: further evidence toward distinct pathologic entities.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24197863 2014 Alpha-internexin and altered CIC expression as a supportive diagnostic marker for oligodendroglial tumors with the 1p/19q co-deletion.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24086756 2013 Novel CIC point mutations and an exon-spanning, homozygous deletion identified in oligodendroglial tumors by a comprehensive genomic approach including transcriptome sequencing.
24030748 2014 Loss of CIC and FUBP1 expressions are potential markers of shorter time to recurrence in oligodendroglial tumors.
23887164 2013 Undifferentiated small round cell sarcoma with t(4;19)(q35;q13.1) CIC-DUX4 fusion: a novel highly aggressive soft tissue tumor with distinctive histopathology.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22869205 2012 Frequent ATRX, CIC, FUBP1 and IDH1 mutations refine the classification of malignant gliomas.
22588899 2012 CIC and FUBP1 mutations in oligodendrogliomas, oligoastrocytomas and astrocytomas.
22526417 2012 The Capicua repressor--a general sensor of RTK signaling in development and disease.
22072542 2012 Concurrent CIC mutations, IDH mutations, and 1p/19q loss distinguish oligodendrogliomas from other cancers.
21817013 2011 Mutations in CIC and FUBP1 contribute to human oligodendroglioma.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21087211 2011 ERK/p90(RSK)/14-3-3 signalling has an impact on expression of PEA3 Ets transcription factors via the transcriptional repressor capicúa.
21076407 2010 A de novo paradigm for mental retardation.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19837261 2009 Detailed cytogenetic and array analysis of pediatric primitive sarcomas reveals a recurrent CIC-DUX4 fusion gene event.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17190598 2006 ATAXIN-1 interacts with the repressor Capicua in its native complex to cause SCA1 neuropathology.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
15981098 2005 CIC, a gene involved in cerebellar development and ErbB signaling, is significantly expressed in medulloblastomas.
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15057824 2004 The DNA sequence and biology of human chromosome 19.
12393275 2002 CIC, a member of a novel subfamily of the HMG-box superfamily, is transiently expressed in developing granule neurons.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
9205841 1997 Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.