Property Summary

NCBI Gene PubMed Count 38
PubMed Score 59.63
PubTator Score 39.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 7.9e-07
psoriasis 6685 2.2e-04
colon cancer 1475 1.8e-03
lung cancer 4473 2.9e-02
Breast cancer 3098 4.7e-02

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.400 2.2e-04
lung cancer 1.600 2.9e-02
colon cancer 1.300 1.8e-03
Breast cancer 1.700 4.7e-02
ovarian cancer 2.100 7.9e-07

Gene RIF (25)

PMID Text
25901506 results of the present study suggest that downregulation of the CIAPIN1 gene in multiple myeloma cells may be associated with the development of this disease.
25889687 CIAPIN1 and ABCA13 may be novel markers of poor outcome in pre-chemotherapy serous carcinoma effusions.
25724898 CIAPIN1 over-expression decreases NHE1 expression and ERK1/2 phosphorylation.
25043809 CIAPIN1 targeted NHE1 to mediate differentiation of K562 cells via ERK1/2 pathway.
24973211 the 25-kDa cleaved fragment of anamorsin was detected in post-mortem brains of Alzheimer and Parkinson disease patients
24676475 lentivirus-vector-mediated RNAi targeting of CIAPIN1 is a potential approach to reverse MDR of breast cancer and CIAPIN1 may participate in MDR of breast cancer by regulating P-glycoprotein and P53 expression.
24123282 The N-terminal methyltransferase-like domain of anamorsin probably functions as a structural scaffold to inhibit methyl transfers.
23989406 Mossbauer and EPR spectra of human anamorsin show that both the M1 motif and the M2 motif bind independently a [2Fe-2S] cluster through the four cysteines of each motif.
23596212 the molecular basis of recognition between Ndor1 and anamorsin and of the electron transfer process, was investigated.
23151078 CIAPIN1 siRNA inhibited proliferation, migration and promotes apoptosis of vascular smooth muscle cells by regulating Bcl-2 and Bax.
22713669 Elevated expression of nuclear CIAPIN1 negatively correlated with the survival of epithelial ovarian cancer patients
22677939 In summary, our work revealed a novel function of CIAPIN1, which might possibly be used as an independent prognostic factor and a potential therapeutic target for pancreatic cancer
21729524 Up-regulation of CIAPIN1 expression may play an important role in pathogenesis of leukemia.
21700214 Anamorsin is a Mia40-dependent but ALR-independent IMS-protein and binds a [2Fe-2S] cluster before and after specific Mia40-driven Cys-oxidation.
20815902 Low expression of CIAPIN1 is associated with colorectal cancer.
20411424 Results of immunohistochemical study showed that CIAPIN1 might play an important role in esophageal carcinogenesis, and it could be considered as a prognostic indicator in esophageal squamous cell carcinoma.
19081179 the CIAPIN1 genet could be used as a clinical marker to identify patients with CCRCC.
18389626 correlation between CIAPIN1 down regulation and decreased MDR1 transcriptional activity were observed.
18299278 Knock down of CIAPIN1 by adenovirus-delivered siRNA may be a potential therapeutic strategy for treatment of hepatocellular carcinoma in which CIAPIN1 is overexpressed.
18293492 CIAPIN1 is a suppressor of gastric cancer cell proliferation; CIAPIN1 might play an important role in the development of human gastric cancer.
18203020 anamorsin expression in DLBCL patients with a low IPI was shown to be an unfavorable biomarker; anamorsin might play some roles in the abnormal growth of DLBCL.
18059532 These findings suggest that downregulating CIAPIN1 could sensitize leukemia cells to chemotherapeutic drugs by downregulating MDR-1 and Bcl-2 and by upregulating Bax.
17935775 CIAPIN1 might be a DNA or RNA methyltransferase.
16957168 CIAPIN1 was localized in both the cytoplasm and the nucleus and was accumulated in the nucleolus. Bioinformatic prediction disclosed a putative nuclear localization signal and a putative nuclear export signal within human CIAPIN1.
16410721 it is concluded that CIAPIN1 confers multidrug resistance in gastric cancer cells, likely by upregulating MDR-1 and MRP-1

AA Sequence

MADFGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPG      1 - 70
STTLHSAEILAEIARILRPGGCLFLKEPVETAVDNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEV     71 - 140
QSVREHLGHESDNLLFVQITGKKPNFEVGSSRQLKLSITKKSSPSVKPAVDPAAAKLWTLSANDMEDDSM    141 - 210
DLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLG    211 - 280
DAFRCASCPYLGMPAFKPGEKVLLSDSNLHDA                                          281 - 312
//

Text Mined References (47)

PMID Year Title
25901506 2015 Cytokine-induced apoptosis inhibitor 1 inhibits the growth and proliferation of multiple myeloma.
25889687 2015 CIAPIN1 and ABCA13 are markers of poor survival in metastatic ovarian serous carcinoma.
25724898 2015 CIAPIN1 targets Na?/H? exchanger 1 to mediate MDA-MB-231 cells' metastasis through regulation of MMPs via ERK1/2 signaling pathway.
25416956 2014 A proteome-scale map of the human interactome network.
25043809 2014 CIAPIN1 targets Na+/H+ exchanger 1 to mediate K562 chronic myeloid leukemia cells' differentiation via ERK1/2 signaling pathway.
24973211 2014 Anamorsin, a novel caspase-3 substrate in neurodegeneration.
24676475 2014 CIAPIN1 gene silencing enhances chemosensitivity in a drug-resistant animal model in vivo.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24123282 2014 Crystal structure of the N-terminal methyltransferase-like domain of anamorsin.
23989406 2013 Human anamorsin binds [2Fe-2S] clusters with unique electronic properties.
23596212 2013 Molecular view of an electron transfer process essential for iron-sulfur protein biogenesis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23151078 2013 CIAPIN1 siRNA inhibits proliferation, migration and promotes apoptosis of VSMCs by regulating Bcl-2 and Bax.
22713669 2012 CIAPIN1 nuclear accumulation predicts poor clinical outcome in epithelial ovarian cancer.
22677939 2012 Overexpression of CIAPIN1 inhibited pancreatic cancer cell proliferation and was associated with good prognosis in pancreatic cancer.
21729524 2011 [Expression of CIAPIN1 gene in BMMNC of patients with leukemia].
21700214 2011 Anamorsin is a [2Fe-2S] cluster-containing substrate of the Mia40-dependent mitochondrial protein trapping machinery.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20815902 2010 Expression of CIAPIN1 in human colorectal cancer and its correlation with prognosis.
20411424 2010 Decreased expression of CIAPIN1 is correlated with poor prognosis in patients with esophageal squamous cell carcinoma.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19081179 2009 CIAPIN1 inhibits the growth and proliferation of clear cell renal cell carcinoma.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18625724 2008 Dre2, a conserved eukaryotic Fe/S cluster protein, functions in cytosolic Fe/S protein biogenesis.
18389626 [Reversal of multidrug resistance of gastric cancer cells by down-regulation of CIAPIN1 with CIAPIN1 siRNA].
18299278 2008 Adenovirus-delivered CIAPIN1 small interfering RNA inhibits HCC growth in vitro and in vivo.
18293492 2007 CIAPIN1 inhibits gastric cancer cell proliferation and cell cycle progression by downregulating CyclinD1 and upregulating P27.
18203020 2008 The expression of anamorsin in diffuse large B cell lymphoma: possible prognostic biomarker for low IPI patients.
18059532 2007 A new apoptosis inhibitor, CIAPIN1 (cytokine-induced apoptosis inhibitor 1), mediates multidrug resistance in leukemia cells by regulating MDR-1, Bcl-2, and Bax.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17935775 2008 Successful expression and purification of human CIAPIN1 in baculovirus-insect cell system and application of this system to investigation of its potential methyltransferase activity.
16957168 2006 Subcellular localization of CIAPIN1.
16410721 2006 CIAPIN1 confers multidrug resistance by upregulating the expression of MDR-1 and MRP-1 in gastric cancer cells.
16381901 2006 The LIFEdb database in 2006.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14970183 2004 Identification of a cytokine-induced antiapoptotic molecule anamorsin essential for definitive hematopoiesis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11483580 2001 Gene expression profiling in human fetal liver and identification of tissue- and developmental-stage-specific genes through compiled expression profiles and efficient cloning of full-length cDNAs.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10493829 1999 Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q.