Property Summary

NCBI Gene PubMed Count 21
PubMed Score 25.08
PubTator Score 15.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung cancer 4740 3.1e-04
psoriasis 6694 3.5e-04
Disease Target Count Z-score Confidence
Xeroderma pigmentosum group D 33 3.36 1.7
Nephroblastoma 51 3.331 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 1.400 3.1e-04
psoriasis -1.100 3.5e-04

Gene RIF (5)

AA Sequence

MKDSLVLLGRVPAHPDSRCWFLAWNPAGTLLASCGGDRRIRIWGTEGDSWICKSVLSEGHQRTVRKVAWS      1 - 70
PCGNYLASASFDATTCIWKKNQDDFECVTTLEGHENEVKSVAWAPSGNLLATCSRDKSVWVWEVDEEDEY     71 - 140
ECVSVLNSHTQDVKHVVWHPSQELLASASYDDTVKLYREEEDDWVCCATLEGHESTVWSLAFDPSGQRLA    141 - 210
SCSDDRTVRIWRQYLPGNEQGVACSGSDPSWKCICTLSGFHSRTIYDIAWCQLTGALATACGDDAIRVFQ    211 - 280
EDPNSDPQQPTFSLTAHLHQAHSQDVNCVAWNPKEPGLLASCSDDGEVAFWKYQRPEGL               281 - 339
//

Text Mined References (27)

PMID Year Title