Property Summary

NCBI Gene PubMed Count 18
PubMed Score 24.19
PubTator Score 15.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung cancer 4473 3.1e-04
psoriasis 6685 3.5e-04
Disease Target Count Z-score Confidence
Nephroblastoma 45 3.334 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -1.100 3.5e-04
lung cancer 1.400 3.1e-04

Synonym

Accession O76071 A0MNN9 Q53FM5
Symbols CIA1
WDR39

Gene

PDB

3FM0  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

PMID Text
24245804 These data suggest that viperin requires CIAO1 for [4Fe-4S] cluster assembly, and acts through an enzymatic, Fe-S cluster- and SAM-dependent mechanism to inhibit viral RNA synthesis.
23891004 CIA2B-CIA1-MMS19 and CIA2A-CIA1 assist different branches of Fe/S protein assembly and intimately link this process to cellular iron regulation via IRP1 Fe/S cluster maturation and IRP2 stabilization.
22190034 HIV-1 IN is identified to have a physical interaction with cytosolic iron-sulfur protein assembly 1 (CIAO1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses

AA Sequence

MKDSLVLLGRVPAHPDSRCWFLAWNPAGTLLASCGGDRRIRIWGTEGDSWICKSVLSEGHQRTVRKVAWS      1 - 70
PCGNYLASASFDATTCIWKKNQDDFECVTTLEGHENEVKSVAWAPSGNLLATCSRDKSVWVWEVDEEDEY     71 - 140
ECVSVLNSHTQDVKHVVWHPSQELLASASYDDTVKLYREEEDDWVCCATLEGHESTVWSLAFDPSGQRLA    141 - 210
SCSDDRTVRIWRQYLPGNEQGVACSGSDPSWKCICTLSGFHSRTIYDIAWCQLTGALATACGDDAIRVFQ    211 - 280
EDPNSDPQQPTFSLTAHLHQAHSQDVNCVAWNPKEPGLLASCSDDGEVAFWKYQRPEGL               281 - 339
//

Text Mined References (24)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24245804 2014 Viperin is an iron-sulfur protein that inhibits genome synthesis of tick-borne encephalitis virus via radical SAM domain activity.
23891004 2013 Human CIA2A-FAM96A and CIA2B-FAM96B integrate iron homeostasis and maturation of different subsets of cytosolic-nuclear iron-sulfur proteins.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22683786 2012 The mammalian DUF59 protein Fam96a forms two distinct types of domain-swapped dimer.
22678362 2012 MMS19 assembles iron-sulfur proteins required for DNA metabolism and genomic integrity.
22678361 2012 MMS19 links cytoplasmic iron-sulfur cluster assembly to DNA metabolism.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21468892 2011 Structure and function of WD40 domain proteins.
21269460 2011 Initial characterization of the human central proteome.
20797633 2010 MMXD, a TFIIH-independent XPD-MMS19 protein complex involved in chromosome segregation.
17937914 2007 Structure of the yeast WD40 domain protein Cia1, a component acting late in iron-sulfur protein biogenesis.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17041588 2006 CUL4-DDB1 ubiquitin ligase interacts with multiple WD40-repeat proteins and regulates histone methylation.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10493829 1999 Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q.
10438340 1999 Structural organization, tissue expression, and chromosomal localization of Ciao 1, a functional modulator of the Wilms' tumor suppressor, WT1.
9556563 1998 Ciao 1 is a novel WD40 protein that interacts with the tumor suppressor protein WT1.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.