Property Summary

NCBI Gene PubMed Count 17
PubMed Score 0.00
PubTator Score 4.01

Knowledge Summary

Patent

No data available

Gene RIF (4)

AA Sequence

MVQIVISSARAGGLAEWVLMELQGEIEARYSTGLAGNLLGDLHYTTEGIPVLIVGHHILYGKIIHLEKPF      1 - 70
AVLVKHTPGDQDCDELGRETGTRYLVTALIKDKILFKTRPKPIITSVPKKV                        71 - 121
//

Text Mined References (18)

PMID Year Title