Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.64
PubTator Score 12.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.300 2.6e-03
ependymoma -1.600 2.4e-03
oligodendroglioma -1.200 5.4e-03
medulloblastoma -2.100 1.3e-04
atypical teratoid / rhabdoid tumor -1.800 1.3e-04
glioblastoma -1.500 1.5e-02
primitive neuroectodermal tumor -1.900 5.1e-03
intraductal papillary-mucinous adenoma (... -1.100 2.6e-02
intraductal papillary-mucinous carcinoma... -1.200 2.8e-02
ovarian cancer 1.900 1.9e-04

Gene RIF (3)

PMID Text
21468578 The present study focused on the expression of chondroitin-synthesizing enzymes in colorectal cancer.
17253960 results suggest that chondroitin polymerization is achieved by multiple combinations of chondroitin synthase-1, chondroitin synthase-2, and chondroitin-polymerizing factor
12907687 The full-length open reading frame consists of 882 amino acids and encodes a typical type II membrane protein. This enzyme contains a beta 3-glycosyltransferase motif and a beta 4-glycosyltransferase motif similar to that found in CSS1.

AA Sequence

MAVRSRRPWMSVALGLVLGFTAASWLIAPRVAELSERKRRGSSLCSYYGRSAAGPRAGAQQPLPQPQSRP      1 - 70
RQEQSPPPARQDLQGPPLPEAAPGITSFRSSPWQQPPPLQQRRRGREPEGATGLPGAPAAEGEPEEEDGG     71 - 140
AAGQRRDGRPGSSHNGSGDGGAAAPSARPRDFLYVGVMTAQKYLGSRALAAQRTWARFIPGRVEFFSSQQ    141 - 210
PPNAGQPPPPLPVIALPGVDDSYPPQKKSFMMIKYMHDHYLDKYEWFMRADDDVYIKGDKLEEFLRSLNS    211 - 280
SKPLYLGQTGLGNIEELGKLGLEPGENFCMGGPGMIFSREVLRRMVPHIGECLREMYTTHEDVEVGRCVR    281 - 350
RFGGTQCVWSYEMQQLFHENYEHNRKGYIQDLHNSKIHAAITLHPNKRPAYQYRLHNYMLSRKISELRYR    351 - 420
TIQLHRESALMSKLSNTEVSKEDQQLGVIPSFNHFQPRERNEVIEWEFLTGKLLYSAAENQPPRQSLSSI    421 - 490
LRTALDDTVLQVMEMINENAKSRGRLIDFKEIQYGYRRVNPMHGVEYILDLLLLYKRHKGRKLTVPVRRH    491 - 560
AYLQQLFSKPFFRETEELDVNSLVESINSETQSFSFISNSLKILSSFQGAKEMGGHNEKKVHILVPLIGR    561 - 630
YDIFLRFMENFENMCLIPKQNVKLVIILFSRDSGQDSSKHIELIKGYQNKYPKAEMTLIPMKGEFSRGLG    631 - 700
LEMASAQFDNDTLLLFCDVDLIFREDFLQRCRDNTIQGQQVYYPIIFSQYDPKVTNGGNPPTDDYFIFSK    701 - 770
KTGFWRDYGYGITCIYKSDLLGAGGFDTSIQGWGLEDVDLYNKVILSGLRPFRSQEVGVVHIFHPVHCDP    771 - 840
NLDPKQYKMCLGSKASTFASTMQLAELWLEKHLGVRYNRTLS                                841 - 882
//

Text Mined References (6)

PMID Year Title
21468578 Chondroitin synthases I, II, III and chondroitin sulfate glucuronyltransferase expression in colorectal cancer.
17253960 2007 Involvement of chondroitin sulfate synthase-3 (chondroitin synthase-2) in chondroitin polymerization through its interaction with chondroitin synthase-1 or chondroitin-polymerizing factor.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12907687 2003 Chondroitin sulfate synthase-3. Molecular cloning and characterization.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.