Property Summary

NCBI Gene PubMed Count 16
PubMed Score 6.54
PubTator Score 7.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

Gene RIF (6)

PMID Text
20453000 Observational study of gene-disease association. (HuGE Navigator)
19844255 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
17690104 sulfated keratan sulfate is produced by beta3GNT7, beta4GalT4, CGn6ST, and KSG6ST
8419650 Sulfate is linked to the carbohydrate chains of HIV-1 glycoproteins gp160, gp120, and gp41 during the endoplasmic reticulum to Golgi transport of the glycoproteins
1433500 Sulfate is linked to the carbohydrate chains of HIV-1 glycoproteins gp160, gp120, and gp41 during the endoplasmic reticulum to Golgi transport of the glycoproteins

AA Sequence

MGMRARVPKVAHSTRRPPAARMWLPRFSSKTVTVLLLAQTTCLLLFIISRPGPSSPAGGEDRVHVLVLSS      1 - 70
WRSGSSFLGQLFSQHPDVFYLMEPAWHVWTTLSQGSAATLHMAVRDLMRSIFLCDMDVFDAYMPQSRNLS     71 - 140
AFFNWATSRALCSPPACSAFPRGTISKQDVCKTLCTRQPFSLAREACRSYSHVVLKEVRFFNLQVLYPLL    141 - 210
SDPALNLRIVHLVRDPRAVLRSREAAGPILARDNGIVLGTNGKWVEADPHLRLIREVCRSHVRIAEAATL    211 - 280
KPPPFLRGRYRLVRFEDLAREPLAEIRALYAFTGLTLTPQLEAWIHNITHGSGIGKPIEAFHTSSRNARN    281 - 350
VSQAWRHALPFTKILRVQEVCAGALQLLGYRPVYSADQQRDLTLDLVLPRGPDHFSWASPD             351 - 411
//

Text Mined References (17)

PMID Year Title
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
19844255 2010 Fine mapping and association studies of a high-density lipoprotein cholesterol linkage region on chromosome 16 in French-Canadian subjects.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
17690104 2007 Enzymes responsible for synthesis of corneal keratan sulfate glycosaminoglycans.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12855678 2003 Golgi localization of carbohydrate sulfotransferases is a determinant of L-selectin ligand biosynthesis.
12626414 2003 Activities and expression pattern of the carbohydrate sulfotransferase GlcNAc6ST-3 (I-GlcNAc6ST): functional implications.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12218059 2002 Enzymatic synthesis in vitro of the disulfated disaccharide unit of corneal keratan sulfate.
12107080 2002 Ectopic expression of a GlcNAc 6-O-sulfotransferase, GlcNAc6ST-2, in colonic mucinous adenocarcinoma.
11352640 2001 Sulfation of endothelial mucin by corneal keratan N-acetylglucosamine 6-O-sulfotransferase (GST-4beta).
11017086 2000 Macular corneal dystrophy type I and type II are caused by distinct mutations in a new sulphotransferase gene.
10491328 1999 Cloning and characterization of a mammalian N-acetylglucosamine-6-sulfotransferase that is highly restricted to intestinal tissue.