Property Summary

NCBI Gene PubMed Count 22
PubMed Score 20.71
PubTator Score 18.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
chronic lymphocytic leukemia 1.422 1.0e-04
malignant mesothelioma -1.600 2.4e-07
osteosarcoma -2.763 6.6e-11
posterior fossa group B ependymoma -1.600 1.2e-07
group 4 medulloblastoma -2.400 2.4e-07
cystic fibrosis 1.574 9.8e-05
periodontitis 1.700 1.1e-32
medulloblastoma, large-cell -2.900 3.7e-06
non-small cell lung cancer 1.031 1.5e-05
adult high grade glioma -1.100 2.0e-04
non primary Sjogren syndrome sicca 1.300 1.4e-02
lung carcinoma 1.200 5.2e-07
ulcerative colitis 1.500 5.3e-04

Protein-protein Interaction (2)

Gene RIF (10)

PMID Text
24799377 A method for O-GlcNAc detection using in vitro sulfation with two N-acetylglucosamine (GlcNAc)-specific sulfotransferases, carbohydrate sulfotransferase 2 and carbohydrate sulfotransferase 4.
21041608 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20677014 Observational study of gene-disease association. (HuGE Navigator)
19898482 Observational study of gene-disease association. (HuGE Navigator)
19571171 report the sites at which N-Acetylglucosamine-6-sulfotransferase-1 is modified with N-linked glycans and the effects that each glycan has on enzyme activity, specificity, and localization.[N-Acetylglucosamine-6-sulfotransferase-1]
19343046 Observational study of gene-disease association. (HuGE Navigator)
16897186 A novel tumor antigen that is specifically expressed in ovarian mucinous, clear cell and papillary serous adenocarcinomas.
12855678 is distributed throughout the Golgi apparatus and orchestrates the biosynthesis of L-selectin ligands
8419650 Sulfate is linked to the carbohydrate chains of HIV-1 glycoproteins gp160, gp120, and gp41 during the endoplasmic reticulum to Golgi transport of the glycoproteins
1433500 Sulfate is linked to the carbohydrate chains of HIV-1 glycoproteins gp160, gp120, and gp41 during the endoplasmic reticulum to Golgi transport of the glycoproteins

AA Sequence

MSRSPQRALPPGALPRLLQAAPAAAPRALLPQWPRRPGRRWPASPLGMKVFRRKALVLCAGYALLLVLTM      1 - 70
LNLLDYKWHKEPLQQCNPDGPLGAAAGAAGGSWGRPGPPPAGPPRAHARLDLRTPYRPPAAAVGAAPAAA     71 - 140
AGMAGVAAPPGNGTRGTGGVGDKRQLVYVFTTWRSGSSFFGELFNQNPEVFFLYEPVWHVWQKLYPGDAV    141 - 210
SLQGAARDMLSALYRCDLSVFQLYSPAGSGGRNLTTLGIFGAATNKVVCSSPLCPAYRKEVVGLVDDRVC    211 - 280
KKCPPQRLARFEEECRKYRTLVIKGVRVFDVAVLAPLLRDPALDLKVIHLVRDPRAVASSRIRSRHGLIR    281 - 350
ESLQVVRSRDPRAHRMPFLEAAGHKLGAKKEGVGGPADYHALGAMEVICNSMAKTLQTALQPPDWLQGHY    351 - 420
LVVRYEDLVGDPVKTLRRVYDFVGLLVSPEMEQFALNMTSGSGSSSKPFVVSARNATQAANAWRTALTFQ    421 - 490
QIKQVEEFCYQPMAVLGYERVNSPEEVKDLSKTLLRKPRL                                  491 - 530
//

Text Mined References (23)

PMID Year Title
24799377 2014 Detecting O-GlcNAc using in vitro sulfation.
22260995 2012 Expression of long-form N-acetylglucosamine-6-O-sulfotransferase 1 in human high endothelial venules.
21041608 2011 Family-based analysis of genetic variation underlying psychosis-inducing effects of cannabis: sibling analysis and proband follow-up.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
19571171 2009 Effects of N-glycosylation on the activity and localization of GlcNAc-6-sulfotransferase 1.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
16897186 2006 Ectopic expression of N-acetylglucosamine 6-O-sulfotransferase 2 in chemotherapy-resistant ovarian adenocarcinomas.
15632306 2004 Role of the carboxyl-terminal region in the activity of N-acetylglucosamine 6-o-sulfotransferase-1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15220337 2004 The stem region of the sulfotransferase GlcNAc6ST-1 is a determinant of substrate specificity.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12855678 2003 Golgi localization of carbohydrate sulfotransferases is a determinant of L-selectin ligand biosynthesis.
12501187 2002 Characterization and mutagenesis of Gal/GlcNAc-6-O-sulfotransferases.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11726653 2002 Specificities of N-acetylglucosamine-6-O-sulfotransferases in relation to L-selectin ligand synthesis and tumor-associated enzyme expression.
11310842 2001 CHST1 and CHST2 sulfotransferase expression by vascular endothelial cells regulates shear-resistant leukocyte rolling via L-selectin.
11056388 2000 Molecular cloning, expression, and chromosomal mapping of human chondroitin 4-sulfotransferase, whose expression pattern in human tissues is different from that of chondroitin 6-sulfotransferase.
11042394 2000 Functional expression and genomic structure of human N-acetylglucosamine-6-O-sulfotransferase that transfers sulfate to beta-N-acetylglucosamine at the nonreducing end of an N-acetyllactosamine sequence.
10528213 1999 L-selectin ligands expressed by human leukocytes are HECA-452 antibody-defined carbohydrate epitopes preferentially displayed by P-selectin glycoprotein ligand-1.
10049591 1999 CHST1 and CHST2 sulfotransferases expressed by human vascular endothelial cells: cDNA cloning, expression, and chromosomal localization.
9722682 1998 Human N-acetylglucosamine-6-O-sulfotransferase involved in the biosynthesis of 6-sulfo sialyl Lewis X: molecular cloning, chromosomal mapping, and expression in various organs and tumor cells.
9712885 1998 Molecular cloning and characterization of an N-acetylglucosamine-6-O-sulfotransferase.