Property Summary

NCBI Gene PubMed Count 16
PubMed Score 26.59
PubTator Score 27.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
chronic lymphocytic leukemia 1.522 3.5e-04
malignant mesothelioma 7.700 6.8e-10
group 4 medulloblastoma -2.100 2.2e-05
cystic fibrosis -1.463 2.1e-05
medulloblastoma, large-cell -2.000 1.4e-04
Amyotrophic Lateral Sclerosis 1.155 5.9e-05
adrenocortical carcinoma -1.629 2.8e-04
tuberculosis and treatment for 6 months -1.300 2.5e-03
intraductal papillary-mucinous carcinoma... -1.900 2.3e-02
lung cancer -1.100 6.2e-03
interstitial cystitis 2.300 2.3e-05
posterior fossa group A ependymoma 1.100 3.2e-04
lung carcinoma -1.200 5.9e-16
gastric carcinoma 1.600 2.1e-02
ulcerative colitis 3.000 1.5e-06
ovarian cancer -2.000 2.6e-06
pituitary cancer -1.800 6.6e-06

Protein-protein Interaction (1)

Gene RIF (3)

PMID Text
26642349 The direct action of CHST15 on the proliferation.
23349846 Findings indicate that GalNAc4S-6ST mRNA expressed by astrocytic tumor cells is associated with poor patient prognosis.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MRHCINCCIQLLPDGAHKQQVNCQGGPHHGHQACPTCKGENKILFRVDSKQMNLLAVLEVRTEGNENWGG      1 - 70
FLRFKKGKRCSLVFGLIIMTLVMASYILSGAHQELLISSPFHYGGFPSNPSLMDSENPSDTKEHHHQSSV     71 - 140
NNISYMKDYPSIKLIINSITTRIEFTTRQLPDLEDLKKQELHMFSVIPNKFLPNSKSPCWYEEFSGQNTT    141 - 210
DPYLTNSYVLYSKRFRSTFDALRKAFWGHLAHAHGKHFRLRCLPHFYIIGQPKCGTTDLYDRLRLHPEVK    211 - 280
FSAIKEPHWWTRKRFGIVRLRDGLRDRYPVEDYLDLFDLAAHQIHQGLQASSAKEQSKMNTIIIGEASAS    281 - 350
TMWDNNAWTFFYDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVERLYSDYLYFASSNKSADDFHEKVT    351 - 420
EALQLFENCMLDYSLRACVYNNTLNNAMPVRLQVGLYAVYLLDWLSVFDKQQFLILRLEDHASNVKYTMH    421 - 490
KVFQFLNLGPLSEKQEALMTKSPASNARRPEDRNLGPMWPITQKILRDFYRPFNARLAQVLADEAFAWKT    491 - 560
T//

Text Mined References (18)

PMID Year Title
26642349 2015 Inhibition of Cell Proliferation and Growth of Pancreatic Cancer by Silencing of Carbohydrate Sulfotransferase 15 In Vitro and in a Xenograft Model.
23349846 2013 Role of GalNAc4S-6ST in astrocytic tumor progression.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16024005 2005 Synthesis of sulfated phenyl 2-acetamido-2-deoxy-D-galactopyranosides. 4-O-Sulfated phenyl 2-acetamido-2-deoxy-beta-D-galactopyranoside is a competitive acceptor that decreases sulfation of chondroitin sulfate by N-acetylgalactosamine 4-sulfate 6-O-sulfotransferase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12874280 2003 A unique nonreducing terminal modification of chondroitin sulfate by N-acetylgalactosamine 4-sulfate 6-o-sulfotransferase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11572857 2001 Human N-acetylgalactosamine 4-sulfate 6-O-sulfotransferase cDNA is related to human B cell recombination activating gene-associated gene.
11073942 2001 Novel G proteins, Rag C and Rag D, interact with GTP-binding proteins, Rag A and Rag B.
11032940 Structure, expression and mutational analysis of the hBRAG gene on 10q in the frequently deleted region in human endometrial cancer.
10749872 2000 Characterization of the human B cell RAG-associated gene, hBRAG, as a B cell receptor signal-enhancing glycoprotein dimer that associates with phosphorylated proteins in resting B cells.
9754571 1998 hBRAG, a novel B cell lineage cDNA encoding a type II transmembrane glycoprotein potentially involved in the regulation of recombination activating gene 1 (RAG1).
9628581 1998 Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
3082866 1986 Difference between N-acetylgalactosamine 4-sulfate 6-O-sulfotransferases from human serum and squid cartilage in specificity toward the terminal and interior portion of chondroitin sulfate.