Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.90
PubTator Score 1.53

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
active Crohn's disease -1.826 7.0e-03
active ulcerative colitis -1.338 1.9e-02
pancreatic ductal adenocarcinoma liver m... -1.297 4.2e-03
tuberculosis 1.900 4.0e-06

Gene RIF (4)

AA Sequence

MGRRCCRRRVLAAACLGAALLLLCAAPRSLRPAFGNRALGSSWLGGEKRSPLQKLYDLDQDPRSTLAKVH      1 - 70
RQRRDLLNSACSRHSRRQRLLQPEDLRHVLVDDAHGLLYCYVPKVACTNWKRVLLALSGQARGDPRAISA     71 - 140
QEAHAPGRLPSLADFSPAEINRRLRAYLAFLFVREPFERLASAYRNKLARPYSAAFQRRYGARIVQRLRP    141 - 210
RALPDARARGHDVRFAEFLAYLLDPRTRREEPFNEHWERAHALCHPCRLRYDVVGKFETLAEDAAFVLGL    211 - 280
AGASDLSFPGPPRPRGAAASRDLAARLFRDISPFYQRRLFDLYKMDFLLFNYSAPSYLRLL             281 - 341
//

Text Mined References (7)

PMID Year Title