Property Summary

NCBI Gene PubMed Count 12
PubMed Score 8.77
PubTator Score 5.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis 1.200 8.4e-04
osteosarcoma 1.136 1.4e-05
glioblastoma -1.100 2.3e-05
medulloblastoma, large-cell -1.200 1.4e-03
intraductal papillary-mucinous adenoma (... -1.300 9.2e-05
intraductal papillary-mucinous carcinoma... -1.400 3.7e-04
intraductal papillary-mucinous neoplasm ... -1.500 3.0e-04
ovarian cancer 2.000 1.4e-05

 GWAS Trait (1)

Gene RIF (2)

PMID Text
20580388 Observational study of gene-disease association. (HuGE Navigator)
12847091 human D4ST-1, C4ST-1, and S4ST-2 have differential roles in dermatan sulfate biosynthesis

AA Sequence

MTKARLFRLWLVLGSVFMILLIIVYWDSAGAAHFYLHTSFSRPHTGPPLPTPGPDRDRELTADSDVDEFL      1 - 70
DKFLSAGVKQSDLPRKETEQPPAPGSMEESVRGYDWSPRDARRSPDQGRQQAERRSVLRGFCANSSLAFP     71 - 140
TKERAFDDIPNSELSHLIVDDRHGAIYCYVPKVACTNWKRVMIVLSGSLLHRGAPYRDPLRIPREHVHNA    141 - 210
SAHLTFNKFWRRYGKLSRHLMKVKLKKYTKFLFVRDPFVRLISAFRSKFELENEEFYRKFAVPMLRLYAN    211 - 280
HTSLPASAREAFRAGLKVSFANFIQYLLDPHTEKLAPFNEHWRQVYRLCHPCQIDYDFVGKLETLDEDAA    281 - 350
QLLQLLQVDRQLRFPPSYRNRTASSWEEDWFAKIPLAWRQQLYKLYEADFVLFGYPKPENLLRD          351 - 414
//

Text Mined References (13)

PMID Year Title
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
20580388 2010 Natural frequency of polymorphisms linked to the chondroitin 4-sulfotransferase genes and its association with placental malaria.
19946888 2010 Defining the membrane proteome of NK cells.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12847091 2003 Specificities of three distinct human chondroitin/dermatan N-acetylgalactosamine 4-O-sulfotransferases demonstrated using partially desulfated dermatan sulfate as an acceptor: implication of differential roles in dermatan sulfate biosynthesis.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10781601 2000 Molecular cloning and expression of two distinct human chondroitin 4-O-sulfotransferases that belong to the HNK-1 sulfotransferase gene family.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.