Property Summary

NCBI Gene PubMed Count 13
PubMed Score 12.81
PubTator Score 11.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
malignant mesothelioma 3232 3.4e-06
psoriasis 6694 3.2e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Dengue shock syndrome 6 3.066 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma -1.200 3.4e-06
psoriasis 1.200 3.2e-03

Protein-protein Interaction (7)

Gene RIF (8)

AA Sequence

MHHQWLLLAACFWVIFMFMVASKFITLTFKDPDVYSAKQEFLFLTTMPEVRKLPEEKHIPEELKPTGKEL      1 - 70
PDSQLVQPLVYMERLELIRNVCRDDALKNLSHTPVSKFVLDRIFVCDKHKILFCQTPKVGNTQWKKVLIV     71 - 140
LNGAFSSIEEIPENVVHDHEKNGLPRLSSFSDAEIQKRLKTYFKFFIVRDPFERLISAFKDKFVHNPRFE    141 - 210
PWYRHEIAPGIIRKYRRNRTETRGIQFEDFVRYLGDPNHRWLDLQFGDHIIHWVTYVELCAPCEIMYSVI    211 - 280
GHHETLEDDAPYILKEAGIDHLVSYPTIPPGITVYNRTKVEHYFLGISKRDIRRLYARFEGDFKLFGYQK    281 - 350
PDFLLN                                                                    351 - 356
//

Text Mined References (15)

PMID Year Title