Property Summary

Ligand Count 1
NCBI Gene PubMed Count 34
PubMed Score 8.44
PubTator Score 10.13

Knowledge Summary

Patent (428)

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Thyrotoxicosis 38 0.0 3.0
Disease Target Count Z-score Confidence
Nicotine dependence 54 3.895 1.9

Expression

  Differential Expression (5)

Disease log2 FC p
adult high grade glioma 1.600 3.6e-04
atypical teratoid / rhabdoid tumor 2.600 1.2e-02
cutaneous lupus erythematosus 1.900 2.9e-03
glioblastoma 2.200 2.1e-03
psoriasis 2.000 2.6e-07

Gene RIF (20)

AA Sequence

MNWSHSCISFCWIYFAASRLRAAETADGKYAQKLFNDLFEDYSNALRPVEDTDKVLNVTLQITLSQIKDM      1 - 70
DERNQILTAYLWIRQIWHDAYLTWDRDQYDGLDSIRIPSDLVWRPDIVLYNKADDESSEPVNTNVVLRYD     71 - 140
GLITWDAPAITKSSCVVDVTYFPFDNQQCNLTFGSWTYNGNQVDIFNALDSGDLSDFIEDVEWEVHGMPA    141 - 210
VKNVISYGCCSEPYPDVTFTLLLKRRSSFYIVNLLIPCVLISFLAPLSFYLPAASGEKVSLGVTILLAMT    211 - 280
VFQLMVAEIMPASENVPLIGKYYIATMALITASTALTIMVMNIHFCGAEARPVPHWARVVILKYMSRVLF    281 - 350
VYDVGESCLSPHHSRERDHLTKVYSKLPESNLKAARNKDLSRKKDMNKRLKNDLGCQGKNPQEAESYCAQ    351 - 420
YKVLTRNIEYIAKCLKDHKATNSKGSEWKKVAKVIDRFFMWIFFIMVFVMTILIIARAD               421 - 479
//

Text Mined References (34)

PMID Year Title