Property Summary

NCBI Gene PubMed Count 195
PubMed Score 135.63
PubTator Score 147.56

Knowledge Summary

Patent (2,140)

Expression

  Differential Expression (13)

Disease log2 FC p
medulloblastoma 1.900 3.7e-04
atypical teratoid / rhabdoid tumor 2.800 1.2e-08
glioblastoma 1.700 2.7e-04
medulloblastoma, large-cell 2.700 4.7e-06
primitive neuroectodermal tumor 2.000 2.1e-03
lung cancer 4.100 6.8e-07
active Crohn's disease 1.392 2.9e-02
lung adenocarcinoma 1.300 1.7e-04
adult high grade glioma 1.100 1.0e-02
non-small cell lung carcinoma 1.300 2.1e-11
acute myeloid leukemia -1.900 7.1e-03
Breast cancer 1.400 1.8e-05
psoriasis 1.700 2.3e-62

Protein-protein Interaction (7)

Gene RIF (193)

PMID Text
26942719 two SNPs (rs6495308 and rs11072768) in CHRNA5-A3-B4 have a indirect effect on lung cancer through smoking behaviors
26909550 These results suggest that exposure to nicotine might negatively impact the apoptotic potential of chemotherapeutic drugs and that alpha5-nAChR/AKT signaling plays a key role in the anti-apoptotic activity of nicotine induced by cisplatin.
26757861 No associations were found between the analyzed variants and smoking, however, there was an association among non-smoking subjects between the A allele of rs16969968 and high body mass index.
26689306 suggest that gene variance in the CHRNA5-CHRNA3-CHRNB4 cluster is associated with an increased risk of death, incidence of COPD and tobacco-related cancer in smokers
26434895 Our meta-analysis provided statistical evidence for a strong association between rs16969968 polymorphism and the risk of lung cancer, especially in smokers and Caucasians.
26228411 This study showed that CHRNA5(rs16969968) interacted with chronic low family support in association with child mental health status
26220977 A novel regulatory SNP association with nicotine dependence was found. Previously observed differences in CHRNA5 mRNA expression and nicotine dependence risk were connected to underlying DNA methylation differences.
26184988 In non-Hispanic White participants, a novel association between rs1289899 in the CHRNA5 gene and posttraumatic stress disorder was observed.
26010901 Data suggest that CHRNA5-A3-B4 gene variants do not exhibit a robust association with smoking cessation and are unlikely to be useful for clinically optimizing smoking cessation pharmacotherapy for Caucasian smokers.
25941207 Preventive interventions in adolescents reduced the genetic risk for smoking from rs16969968 CHRNA5.
25674902 Results indicate that the minor alleles of both polymorphisms modulate response speed in a sex-dependent, diametrically opposed manner.
25652844 A low to moderate level of Nicotine Dependence in the Kashubians, of Poland, influenced by age, sex, as well as the CHRNA5 rs16969968 variant was demonstrated
25474695 CHRNA5-A3-B4 genotype associates with body mass index in never smokers.
25384568 Study provides new evidence that the overexpression of the CHRNA5/A3/B4 region disrupts pyramidal neuronal structure in the hippocampus, and thus affecting the cognitive capacities
25329654 CHRNA5 rs3841324 combined variant genotypes (ins/del+del/del) had a >1.5-fold elevated risk for nasopharyngeal carcinoma
25297392 Suggest no relationship between these smoking-related SNPs in the CHRNA5/A3/B4 gene cluster and psoriasis vulgaris in Chinese Han population.
25293386 In Mendelian randomisation analyses, there was no strong evidence that the minor allele of rs16969968/rs1051730 was associated with depression, anxiety or psychological distress in current or former smokers. [Meta-analysis]
25187487 Single nucleotide polymorphism in CHRNA5 is associated with lung cancer.
25073833 The CHRNA5 genetic risk synergized the effect of partner smoking, producing an especially low likelihood of successful smoking reduction in two complementary studies.
25072098 Genetic variation in CHRNA5 protein influence smoking behaviors and the level of carbon monoxide.
25051068 Four SNPs in the CHRNA3/5 locus are associated with chronic obstructive pulmonary disease risk. [Meta-analysis]
24934182 CHRNA5 SNPs predicted nicotine deprivation-induced reduction in cognitive control.
24819610 Data found that DRD2 rs1076560 and CHNRA5 rs16969968 interact to modulate cognitive function, prefrontal physiology during working memory, and prefrontal gray matter volume.
24793809 Silencing of alpha5-nAChR significantly inhibits nicotine-induced cell proliferation in tumor cell lines.
24733007 Among African Americans, CHRNA5-A3-B4 variants are not associated with smoking but can influence smoking abstinence.
24727484 Among smokers who are hospitalized with acute myocardial infarction, the high-risk CHRNA5 allele was associated with lower likelihood of quitting before hospitalization and significantly less abstinence 1 year after hospitalization with MI.
24719457 Increased expression of NeuroD1 subsequently leads to regulation of expression and function of the nicotinic acetylcholine receptor subunit cluster of alpha3, alpha5, and beta4.
24682045 in African-Americans, variants (common or rare) in genes other than CHRNA5 most likely contribute toward the nicotine-dependent phenotype.
24588897 Investigated associations between neuroticism and 13 SNPs in the CHRNA5 and CHRNA3 genes in young adult Mexican American men and women.
24303001 substance dependence associated variants have a direct cis-regulatory effect on CHRNA5 transcript levels in human frontal cortices of African and European ancestry.
24184962 the alpha5 subunit can occupy the position of a nonbinding subunit, or replace a beta2 subunit participating in a canonical binding site.
24033696 The effect of nicotine replacement on continuous abstinence is moderated by the combined genetic risks from CYP2A6 and CHRNA5.
23943838 Level of cigarettes per day during adolescence and young adulthood is associated with CHRNB3A6, CHRNA5A3B4, and CHRNA2
23844051 CHRNA5-A3-B4 rs667282 TT/TG genotypes were associated with significantly increased risk of esophageal squamous cell carcinoma.
23843950 Nicotinic acetylcholine receptor subunits alpha4 and alpha5 associated with smoking behavior and lung cancer are regulated by upstream open reading frames.
23729684 SNP rs1051730 associated with smoking and body mass index
23692359 Genetic variants in the CHRNA5-A3-B4 gene cluster alter nicotine intake and body mass index in a population of Alaska Native people, who have a distinct haplotype structure, smoking behaviors and prevalence of obesity.
23576140 Evaluated the association between CHRNA5-A3-B4 gene cluster variants (rs667282 and rs3743073, two variants modifying lung cancer risk) and risk of gastric cancer.
23458267 Rare genetic variation in the CHRNA5-A3-B4 gene cluster contributes modestly to the level of response to alcohol.
23430818 our findings provide evidence for the presence of multiple CHRNA5 mRNA isoforms that may modulate the multimeric nicotine receptor and cis-regulatory variations in the CHRNA5 locus that act in vivo in the control of CHRNA5 mRNA expression
23358500 The present study investigated the association of CHRNA5 polymorphisms and smoking topography.
23314339 the heterozygous genotype c.-166T>A at rs503464 of CHRNA5 may be associated with reduced risk of lung cancer, thus representing a susceptibility allele in Chinese individuals.
23308091 Findings of this study suggest that personality measures may play an important role in substance use disorders on both environmental (marriage) and genetic rs16969968 in CHRNA5 levels.
23249876 Nicotinic acetylcholine receptor single nucleotide polymorphism is associated with response to smoking cessation therapies.
23221128 Single-nucleotide polymorphism in the CHRNA5 gene is associated with lung cancer susceptibility.
23143843 Genetic variation in the CHRNA5-CHRNA3-CHRNB4 gene cluster, encoding the alpha5, alpha3, and beta4 nAChR subunits, respectively, has been shown to increase vulnerability to tobacco dependence.
23061658 The intronic rs871058, that is highly correlated with rs16969968 in CHRNA5, while shows a modest treatment effect for subjects who possess the rare allele has a large effect for not carriers.
23029550 Associations between variation in CHRNA5-CHRNA3-CHRNB4, body mass index and blood pressure in smokers and non-smokers.
23011884 results showed that several of the polymorphisms and their haplotypes in CHRNA5/CHRNA3 genes may have functional effects on (i) CHRNA5 mRNA levels, (ii) polycyclic aromatic hydrocarbon-DNA adduct levels, (iii) susceptibility to lung cancer
22956269 Genetic variation in the 15q25 nicotinic acetylcholine receptor gene cluster (CHRNA5-CHRNA3-CHRNB4) interacts with maternal self-reported smoking status during pregnancy to influence birth weight.
22914670 CHRNA5 polymorphism was associated with pack-year of smoking in chronic obstructive pulmonary disease Chinese Han patients
22884254 The rs588765 nicotine dependence risk allele 'C' was associated with delayed age at onset among ever-smokers(even when smoking intensity variables are accounted for), but had no significant effect among never smoked.
22868939 The genetic risk of heavy smoking (as measured by the rs16969968 A allele) is greater in early-onset smokers (onset of smoking at <16 years) compared with later-onset smokers (Meta-Analysis)
22837378 Results suggest important role for CHRNA5 variants as genetic risk factor for airflow obstruction that may be independent of smoking status.
22820273 alpha3beta4alpha5 nicotinic acetylcholine receptors, expressing the the N398 variant of CHRNA5, exhibits a reduced response to agonists when extracellular calcium is high and it may lead to distinct downstream cellular signaling.
22665477 The alpha5 variant-induced change in alpha3beta4alpha5 nAChR function may underlie some of the phenotypic changes associated with this polymorphism.
22461431 A replication of association between two SNPs previously associated with COPD (CHRNA3/5 and IREB2), as well as an association with COPD of one locus initially associated with lung function (ADCY2).
22459873 transgenic mice with human alpha 5, alpha 3, beta 4 subunit genes drank less ethanol than wild-type in a two-bottle (ethanol vs. water) preference test
22406075 The A allele of the single nucleotide polymorphism rs16969968 (alpha5, G > A), which correlates with the development of lung cancer, shows a non-significant trend to be associated with cervical lesions.
22382757 study provides evidence for a general role of the CHRNA5/A3/B4 gene cluster in substance use initiation that is not limited to nicotine and alcohol.
22382680 Collectively, the presence of alpha7 and beta4 nAChRs in PDLSCs supports a key role of Nicotinic acetylcholine receptor (nAChRs) in the modulation of nicotine-induced apoptosis
22336398 The genetic risks of nicotine dependence associated with the CHRNA5-A3-B4 subunit genes are specific, and not shared among commonly comorbid psychiatric disorders
22241830 Genetic variation within the CHRNA5-CHRNA3-CHRNB4 gene cluster is associated with nicotine dependence.
22223462 Single nucleotide polymorphisms in CHRNA5 gene is associated with nicotine dependence.
22101982 vivo evidence of the involvement of the CHRNA5, CHRNA3 and CHRNB4 genomic cluster in nicotine addiction
22042234 This study examines whether the CHRNA5/CHRNA3/CHRNB4 locus is correlated also with externalizing behaviors in three independent longitudinally assessed adolescent samples
22024278 Two specific aspects of executive functioning related to drug addiction--impulsivity and working memory--are demonstrated in transgenic mice overexpressing alpha3/alpha5/beta4 nicotinic receptor subunits.
22017462 An interaction between tobacco smoke exposure and a CHRNA3/5 polymorphism was found for BHR in children, but CHRNA3/5 was not associated with asthma or lung function.
22012472 This study provides evidence of a sex-specific gene x environment effect of CHRNA5 and childhood adversity on the risk for nicotine dependence
22008662 results confirm the involvement of the CHRNA5 gene in the amount of nicotine use and further suggest involvement of the BDNF gene in smoking behavior
21955800 Relationship between the polymorphism of the CHRNA5 gene and the strength of nicotine addiction measured by multiple factors including the Fagerstrom test score.
21873428 analysis of how nicotinic acetylcholine receptor (nAChR) alpha5 subunits and/or variants modulate function of alpha6*-nAChR
21858091 Data show that luciferase expression was equivalent among CHRNA3 haplotypes, but the combination of deletion at rs3841324 and variation at rs503464 decreased CHRNA5 promoter-derived luciferase activity.
21810735 Women with the variant AA genotype of CHRNA5 rs16969968 or variant CC genotype of LOC123688 rs8034191 were at significantly increased risk of heavy smoking.
21765098 CHRNA5 and CYP2A6 genotypes appeared to be independent, with each approximately doubling the odds of being a regular smoker by age 18 years.
21764527 nicotine-dependent smokers lacking the rs16969968 A allele are more likely to recall smoking-related memories and engage in habitual responding to smoking cues than A allele smokers
21748402 CHRNA3 and CHRNA5 have roles in different forms of tobacco dependence, but the specific genetic variants do not account for much fo the total genetic variance for predisposition to nicotine dependence
21747048 Variation in CHRNA5-A3-B4 was independently and additively associated with increased smoking, nicotine dependence, and lung cancer risk.
21646606 Nicotinic acetylcholine receptor polymorphisms are associated with additional increased risk of lung cancer, bladder cancer, and chronic obstructive pulmonary disease after adjustment for smoking.
21593077 Common variation in the CHRNA5-CHRNA3-CHRNB4 gene region (chromosome 15q25) IS ASSOCIATED WITH SMOKING QUANTITY AND THE GENOTYPE MAY BE associated with BMI in smokers
21586512 results demonstrate a role for CHRNA5 in modulating adhesion and motility in bronchial cells, as well as in regulating p63, a potential oncogene in squamous cell carcinoma
21559498 CHRNA3-CHRNA5 variation impacts indirectly on lung cancer risk
21448929 Results indicate that the CHRNA5 gene with under-activated or over-activated promoter activity may be protective against lung cancer, implying a complex role of the CHRNA5 gene in lung cancer.
21440309 This study demonistreated that CHRNA5 polymorphism(16969968) are more common among Posttraumatic Stress Disorder.
21436384 Single Nucleotide Polymorphisms in CHRNA5 is associated with smoking persistence in African Americans.
21418140 The Asp398Asn risk allele is significantly associated with smoking severity independently in schizophrenia patient smokers and control smokers.
21385908 This study demonstrates the additive and independent association of the nicotine metabolite ratio and SNPs in the CHRNA5/A3/B4 gene cluster with smoking rate in treatment-seeking smokers.
21321393 nAChR7-specific antibodies are able to penetrate the brain upon inflammation, with resulting decreases of brain nAChR7 receptor and worsening episodic memory.
21248747 Variant A of the rs1051730 SNP of CHRNA5-A3-B4 gene cluster was significantly associated with smoking quantity in 2 Italian populations, Val Borbera and Cilento, no association was found in Carlantino population.
21228559 Single nucleotide polymorphism (SNP) CHRNA5 on chromosome 15 is not associated with Parkinson's disease risk in the overall anaylsis or after stratifying on smoking status.
21168125 CHRNA5-CHRNA3-CHRNB4 is involved in the transition toward heavy smoking in mid-adulthood and in smoking persistence.
20886544 evidence that CHRNA5-CHRNA3-CHRNB4 gene cluster variants,particularly CHRNA5 variant rs16969968, could be associated with cognitive performance possibly mediating in part risk for developing nicotine dependence
20886544 Observational study of gene-disease association. (HuGE Navigator)
20881005 A variation in the alpha5 subunit of nicotinic acetylcholine receptors increases the risk of nicotine dependence and lung cancer.
20854418 Observational study of gene-disease association. (HuGE Navigator)
20840187 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20808433 associations of variants in the CHRNA5/A3/B4 cluster with smoking initiation, smoking quantity and smoking cessation
20808433 Observational study of gene-disease association. (HuGE Navigator)
20736995 Observational study of gene-disease association. (HuGE Navigator)
20734064 Observational study of gene-disease association. (HuGE Navigator)
20733116 Study identified four genetic variations in the CHRNA5 promoter region that define three haplotypes affecting activity of the promoter of this gene, thus modulating CHRNA5 transcript levels in normal lung tissue.
20733116 Observational study of gene-disease association. (HuGE Navigator)
20725741 Observational study of gene-disease association. (HuGE Navigator)
20700147 The enhancer region and the nonsynonymous polymorphism rs16969968 generate three main haplotypes that alter the risk of developing nicotine dependence.
20691427 Observational study of gene-disease association. (HuGE Navigator)
20685379 This review focuses on the clustered nicotinic acetylcholine receptor genes CHRNalpha5/alpha3/beta4 and evaluates their role in nicotine addiction and lung cancer.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20656943 The CHRNA3/5 locus was associated with increased smoking intensity and emphysema in individuals with COPD
20656943 Observational study of gene-disease association. (HuGE Navigator)
20643934 Data suggest that both CHNA5 Asp398Asn and CHRNA3 rs578776 are associated with smoking.
20643934 Observational study of gene-disease association. (HuGE Navigator)
20631687 Genetic variation in CHRNA5-CHRNA3-CHRNB4 nicotinic acetylcholine receptor gene cluster influences cognitive flexibility differently in African Americans and European Americans.
20631687 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20624154 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20587604 Observational study of gene-disease association. (HuGE Navigator)
20584212 Observational study of gene-disease association. (HuGE Navigator)
20564069 Smoking behavior and COPD are mediators of the association between the single nucleotide polymorphism (SNP) rs1051730 and the risk of lung cancer.
20564069 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20554942 Observational study of gene-disease association. (HuGE Navigator)
20548021 Meta-analysis of gene-disease association. (HuGE Navigator)
20485328 The data of this study supported the importance of variants in the CHRNA5/A3/B4 gene cluster as mediators of the genetic risk for substance dependence.
20485328 Observational study of gene-disease association. (HuGE Navigator)
20418889 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20395203 Observational study of gene-disease association. (HuGE Navigator)
20381163 This study suggested that the possibility that the wide individual variability in response, and sequent sensitization to nicotine are due to both a variant Single Nucleotide Polymorphism in rs16969989 and early life stress.
20381163 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19955392 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19859904 These results indicate that variants within CHRNA3 and among CHRNA5, CHRNA3, and CHRNB4 contribute significantly to the etiology of ND through gene-gene interactions.
19859904 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19776245 Observational study, meta-analysis, and genome-wide association study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19733931 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19706762 CHRNA5 SNP rs16969968 is the most significant SNP associated with nicotine dependence
19706762 Observational study of gene-disease association. (HuGE Navigator)
19696770 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19671882 Observational study of gene-disease association. (HuGE Navigator)
19641473 Single Nucleotide Polymorphism in CHRNA5 is associated with non-small cell lung cancer.
19641473 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19628476 Genetic variation at CHRNA5/CHRNA3/CHRNB4 cluster influences blood nicotine level.
19628476 Observational study of gene-disease association. (HuGE Navigator)
19577767 Although CHRNA5 polymorphism is rare from Japanese lung cancer, polymorphism status might be correlated with shorter survival.
19482438 There was no evidence of association of CHRNA5 rs16969968 with smoking status (p=0.28) or, among daily smokers, of association with cotinine levels (p=0.49).
19482438 Observational study of gene-disease association. (HuGE Navigator)
19443489 Two distinct mechanisms conferring risk for nicotine dependence and lung cancer: altered receptor function caused by a D398N amino acid variant in CHRNA5 and variability in CHRNA5 mRNA expression.
19436041 The CHRNA5-A3-B4 haplotypes are associated with a broad range of nicotine dependence phenotypes, but these associations are not consistently moderated by age at initial smoking.
19429911 Genetic variant in the CHRNA5-CHRNA3-CHRNB4 gene cluster is associated with smoking cessation during pregnancy.
19429911 Observational study of gene-disease association. (HuGE Navigator)
19390575 Observational study of gene-disease association. (HuGE Navigator)
19300482 The CHRNA 3/5 and the HHIP loci make a significant contribution to the risk of COPD.
19300482 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19259974 Observational study of gene-disease association. (HuGE Navigator)
19247474 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19223495 D398N polymorphism of the CHRNA5 gene was associated with lung adenocarcinoma.
19223495 Observational study of gene-disease association. (HuGE Navigator)
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19132693 The alpha5 and alpha3 subunits play a significant role in both nicotine dependence and alcohol abuse/dependence.
19132693 Observational study of gene-disease association. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
19029397 Two distinct variant groups in the CHRNA5-CHRNA3-CHRNB4 gene cluster are strongly associated with heavy smoking. The snp rs16969968 alters the coding sequence of these genes.
19029397 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19010884 smokers who carry the CHRNA3 and CHRNA5 variants are expected to be at increased risk for lung cancer compared with smokers who do not carry these alleles.
19010884 Observational study of gene-disease association. (HuGE Navigator)
19005185 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18996504 CHRNA5 seem to exert no relevant influence on smoking cessation probability in heavy smokers in the general population.
18996504 Observational study of gene-disease association. (HuGE Navigator)
18978134 the association between the alpha5 subunit nicotinic acetylcholine receptor single nucleotide polymorphism and lung cancer may, in part, be confounded by chronic obstructive pulmonary disease
18978134 Observational study of gene-disease association. (HuGE Navigator)
18957677 The CHRNA5-A3 region on chromosome 15q24-25.1 is a risk factor both for nicotine dependence and for lung cancer.(
18957677 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18783506 A non-synonymous coding SNP in CHRNA5 was associated with case status and, in Caucasians, with experiencing a pleasurable rush or buzz during the first cigarette; these sensations were associated highly with current smoking (OR = 8.2, P = 0.0001).
18783506 Observational study of gene-disease association. (HuGE Navigator)
18780872 Observational study of gene-disease association. (HuGE Navigator)
18759969 Correlated SNPs in the cholinergic nicotinic receptor gene cluster CHRNA5-CHRNA3-CHRNB4, in a case-control study of cocaine dependence composed of 504 European-American and 583 African-Americans.
18618000 In the 2,827 long-term smokers examined, common susceptibility and protective haplotypes at the CHRNA5-A3-B4 locus were associated with nicotine dependence severity.
18559515 Increased levels of cholinergic receptor nicotinic alpha 5 is associated with squamous cell lung carcinoma
18519524 Observational study of gene-disease association. (HuGE Navigator)
18519132 Observational study of gene-disease association. (HuGE Navigator)
18450646 Environmental tobacco smoke and nicotine up-regulated the levels of alpha5 and alpha7 expression in a time-dependent fashion
18414406 Functional studies in human brain reveal that the variants associated with alcohol dependence are also associated with altered steady-state levels of CHRNA5 mRNA.
18414406 Observational study of gene-disease association. (HuGE Navigator)
18385738 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18385676 CHRNA5 and CHRNA3 are promising candidate genes in the region of 15q25.1 for lung cancer.
18385676 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18227835 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18227835 A common haplotype in the CHRNA5/CHRNA3 gene cluster on chromosome 15 contains alleles, which predispose to nicotine dependence.
18165968 From a panel of 59 single-nucleotide polymorphisms (SNPs) located on 11 candidate genes, we identify four SNPs (one each on CHRNA5 and CHRNA2 and two on CHAT) that appear to have pharmacogenetic relevance in smokin cessation therapy.
18165968 Observational study of gene-disease association. (HuGE Navigator)
18163978 Observational study of gene-disease association. (HuGE Navigator)
17559419 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17373692 Observational study of gene-disease association. (HuGE Navigator)
17135278 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAARGSGPRALRLLLLVQLVAGRCGLAGAAGGAQRGLSEPSSIAKHEDSLLKDLFQDYERWVRPVEHLND      1 - 70
KIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTPDIVLFDNAD     71 - 140
GRFEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFDLQNCSMKFGSWTYDGSQVDIILEDQDVDKR    141 - 210
DFFDNGEWEIVSATGSKGNRTDSCCWYPYVTYSFVIKRLPLFYTLFLIIPCIGLSFLTVLVFYLPSNEGE    211 - 280
KICLCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLVFTMIFVTLSIMVTVFAINIHHRSSSTHNAMAP    281 - 350
LVRKIFLHTLPKLLCMRSHVDRYFTQKEETESGSGPKSSRNTLEAALDSIRYITRHIMKENDVREVVEDW    351 - 420
KFIAQVLDRMFLWTFLFVSIVGSLGLFVPVIYKWANILIPVHIGNANK                          421 - 468
//

Text Mined References (196)

PMID Year Title
26942719 2016 Chromosome 15q25 (CHRNA3-CHRNB4) Variation Indirectly Impacts Lung Cancer Risk in Chinese Males.
26909550 2016 Nicotine Inhibits Cisplatin-Induced Apoptosis via Regulating ?5-nAChR/AKT Signaling in Human Gastric Cancer Cells.
26757861 2015 [Association between genotype and allele frequencies of CYP2A6*12 and rs16969968 in CHRNA5 variants with smoking and body mass index in young subjects from Northeast Mexico].
26689306 2016 Gene variance in the nicotinic receptor cluster (CHRNA5-CHRNA3-CHRNB4) predicts death from cardiopulmonary disease and cancer in smokers.
26434895 2015 CHRNA5 rs16969968 Polymorphism Association with Risk of Lung Cancer--Evidence from 17,962 Lung Cancer Cases and 77,216 Control Subjects.
26228411 2015 Examining gene-environment interactions in comorbid depressive and disruptive behavior disorders using a Bayesian approach.
26220977 2015 A multiancestry study identifies novel genetic associations with CHRNA5 methylation in human brain and risk of nicotine dependence.
26184988 2015 Effect of genetic variation in the nicotinic receptor genes on risk for posttraumatic stress disorder.
26010901 2015 Lack of Associations of CHRNA5-A3-B4 Genetic Variants with Smoking Cessation Treatment Outcomes in Caucasian Smokers despite Associations with Baseline Smoking.
25941207 2016 An Adolescent Substance Prevention Model Blocks the Effect of CHRNA5 Genotype on Smoking During High School.
25674902 2015 Sex matters! Interactions of sex and polymorphisms of a cholinergic receptor gene (CHRNA5) modulate response speed.
25652844 2015 Nicotine dependence in an isolated population of Kashubians from North Poland: a population survey.
25474695 2014 Stratification by smoking status reveals an association of CHRNA5-A3-B4 genotype with body mass index in never smokers.
25384568 2014 Hippocampal changes produced by overexpression of the human CHRNA5/A3/B4 gene cluster may underlie cognitive deficits rescued by nicotine in transgenic mice.
25329654 2014 Role of a genetic variant on the 15q25.1 lung cancer susceptibility locus in smoking-associated nasopharyngeal carcinoma.
25297392 2014 An association study on the CHRNA5/A3/B4 gene cluster, smoking and psoriasis vulgaris.
25293386 2014 Investigating the possible causal association of smoking with depression and anxiety using Mendelian randomisation meta-analysis: the CARTA consortium.
25187487 2014 Susceptibility loci for lung cancer are associated with mRNA levels of nearby genes in the lung.
25101718 2015 IREB2 and GALC are associated with pulmonary artery enlargement in chronic obstructive pulmonary disease.
25073833 2014 Interplay of genetic risk (CHRNA5) and environmental risk (partner smoking) on cigarette smoking reduction.
25072098 2014 Beyond cigarettes per day. A genome-wide association study of the biomarker carbon monoxide.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
25051068 2014 Four SNPs in the CHRNA3/5 alpha-neuronal nicotinic acetylcholine receptor subunit locus are associated with COPD risk based on meta-analyses.
25006744 2014 Genome-wide association identifies regulatory Loci associated with distinct local histogram emphysema patterns.
24934182 2014 CHRNA5 variants moderate the effect of nicotine deprivation on a neural index of cognitive control.
24819610 2014 DRD2/CHRNA5 interaction on prefrontal biology and physiology during working memory.
24793809 2014 ?5 Nicotinic acetylcholine receptor mediates nicotine-induced HIF-1? and VEGF expression in non-small cell lung cancer.
24733007 2014 Association of CHRNA5-A3-B4 SNP rs2036527 with smoking cessation therapy response in African-American smokers.
24727484 2014 CHRNA5 variant predicts smoking cessation in patients with acute myocardial infarction.
24719457 2014 NeuroD1 mediates nicotine-induced migration and invasion via regulation of the nicotinic acetylcholine receptor subunits in a subset of neural and neuroendocrine carcinomas.
24682045 2014 Identification of CHRNA5 rare variants in African-American heavy smokers.
24588897 2014 CHRNA5 and CHRNA3 variants and level of neuroticism in young adult Mexican American men and women.
24303001 2013 Cis-regulatory variants affect CHRNA5 mRNA expression in populations of African and European ancestry.
24184962 2014 The nicotinic ?5 subunit can replace either an acetylcholine-binding or nonbinding subunit in the ?4?2* neuronal nicotinic receptor.
24033696 2014 Pharmacotherapy effects on smoking cessation vary with nicotine metabolism gene (CYP2A6).
23943838 2014 Effect of neuronal nicotinic acetylcholine receptor genes (CHRN) on longitudinal cigarettes per day in adolescents and young adults.
23844051 2013 Association of CHRNA5-A3-B4 variation with esophageal squamous cell carcinoma risk and smoking behaviors in a Chinese population.
23843950 2013 Nicotinic acetylcholine receptor subunits ?4 and ?5 associated with smoking behaviour and lung cancer are regulated by upstream open reading frames.
23729684 2013 Smoking status, snus use, and variation at the CHRNA5-CHRNA3-CHRNB4 locus in relation to obesity: the GLACIER study.
23692359 2013 CHRNA5-A3-B4 genetic variants alter nicotine intake and interact with tobacco use to influence body weight in Alaska Native tobacco users.
23576140 2013 Is susceptibility locus for lung cancer in the 15q25 nicotinic acetylcholine receptor gene cluster CHRNA5-A3-B4 associated with risk of gastric cancer?
23458267 2013 Examination of rare missense variants in the CHRNA5-A3-B4 gene cluster to level of response to alcohol in the San Diego Sibling Pair study.
23430818 2013 Multiple isoforms and differential allelic expression of CHRNA5 in lung tissue and lung adenocarcinoma.
23358500 2014 Variation in the ? 5 nicotinic acetylcholine receptor subunit gene predicts cigarette smoking intensity as a function of nicotine content.
23314339 2013 CHRNA5 polymorphism and susceptibility to lung cancer in a Chinese population.
23308091 2013 A complex interplay between personality domains, marital status and a variant in CHRNA5 on the risks of cocaine, nicotine dependences and cocaine-induced paranoia.
23249876 2013 Nicotinic acetylcholine receptor variation and response to smoking cessation therapies.
23221128 2013 Fine-mapping of the 5p15.33, 6p22.1-p21.31, and 15q25.1 regions identifies functional and histology-specific lung cancer susceptibility loci in African-Americans.
23143843 2013 Molecular mechanisms underlying behaviors related to nicotine addiction.
23061658 2012 Role of CHRNA5-A3 genetic Locus variants and developing drug for chronic obstructive pulmonary disease.
23029550 2012 Associations between variation in CHRNA5-CHRNA3-CHRNB4, body mass index and blood pressure in the Northern Finland Birth Cohort 1966.
23022100 2012 Discovery and fine mapping of serum protein loci through transethnic meta-analysis.
23011884 2013 Functional effect of polymorphisms in 15q25 locus on CHRNA5 mRNA, bulky DNA adducts and TP53 mutations.
22956269 2012 Genetic variation in the 15q25 nicotinic acetylcholine receptor gene cluster (CHRNA5-CHRNA3-CHRNB4) interacts with maternal self-reported smoking status during pregnancy to influence birth weight.
22914670 2012 Association of IREB2 and CHRNA3/5 polymorphisms with COPD and COPD-related phenotypes in a Chinese Han population.
22884254 2013 Association of nicotine dependence susceptibility gene, CHRNA5, with Parkinson's disease age at onset: gene and smoking status interaction.
22868939 2012 Increased genetic vulnerability to smoking at CHRNA5 in early-onset smokers.
22837378 2012 Genome-wide association studies identify CHRNA5/3 and HTR4 in the development of airflow obstruction.
22832964 2012 Genome-wide meta-analyses of smoking behaviors in African Americans.
22820273 2012 Impact of human D398N single nucleotide polymorphism on intracellular calcium response mediated by ?3?4?5 nicotinic acetylcholine receptors.
22665477 2012 Function of human ?3?4?5 nicotinic acetylcholine receptors is reduced by the ?5(D398N) variant.
22461431 2012 CHRNA3/5, IREB2, and ADCY2 are associated with severe chronic obstructive pulmonary disease in Poland.
22459873 2012 Transgenic over expression of nicotinic receptor alpha 5, alpha 3, and beta 4 subunit genes reduces ethanol intake in mice.
22406075 2012 Association of single nucleotide polymorphisms of nicotinic acetylcholine receptor subunits with cervical neoplasia.
22382757 2012 The CHRNA5/A3/B4 gene cluster and tobacco, alcohol, cannabis, inhalants and other substance use initiation: replication and new findings using mixture analyses.
22382680 2012 Nicotinic acetylcholine receptor ?7 and ?4 subunits contribute nicotine-induced apoptosis in periodontal ligament stem cells.
22336398 2012 Nicotine dependence and comorbid psychiatric disorders: examination of specific genetic variants in the CHRNA5-A3-B4 nicotinic receptor genes.
22241830 2012 Analysis of detailed phenotype profiles reveals CHRNA5-CHRNA3-CHRNB4 gene cluster association with several nicotine dependence traits.
22223462 2012 Alpha-5 and -3 nicotinic receptor gene variants predict nicotine dependence but not cessation: findings from the COMMIT cohort.
22101982 2012 Overexpression of the CHRNA5/A3/B4 genomic cluster in mice increases the sensitivity to nicotine and modifies its reinforcing effects.
22080838 2012 A genome-wide association study of COPD identifies a susceptibility locus on chromosome 19q13.
22042234 2012 Externalizing behaviors are associated with SNPs in the CHRNA5/CHRNA3/CHRNB4 gene cluster.
22024278 2012 Overexpression of ?3/?5/?4 nicotinic receptor subunits modifies impulsive-like behavior.
22017462 2012 Alpha-nicotinic acetylcholine receptor and tobacco smoke exposure: effects on bronchial hyperresponsiveness in children.
22012472 2012 Childhood adversity increases risk for nicotine dependence and interacts with ?5 nicotinic acetylcholine receptor genotype specifically in males.
22008662 2012 The association of the alpha-5 subunit of the nicotinic acetylcholine receptor gene and the brain-derived neurotrophic factor gene with different aspects of smoking behavior.
21955800 2012 The polymorphism of the CHRNA5 gene and the strength of nicotine addiction in lung cancer and COPD patients.
21946350 2011 Genome-wide association and large-scale follow up identifies 16 new loci influencing lung function.
21873428 2011 Reporter mutation studies show that nicotinic acetylcholine receptor (nAChR) ?5 Subunits and/or variants modulate function of ?6*-nAChR.
21858091 2011 In vitro and ex vivo analysis of CHRNA3 and CHRNA5 haplotype expression.
21810735 2011 Single nucleotide polymorphisms in CHRNA5 rs16969968, CHRNA3 rs578776, and LOC123688 rs8034191 are associated with heaviness of smoking in women in Northeastern Ontario, Canada.
21765098 2011 Combined analysis of CHRNA5, CHRNA3 and CYP2A6 in relation to adolescent smoking behaviour.
21764527 2012 Association between CHRNA5 genetic variation at rs16969968 and brain reactivity to smoking images in nicotine dependent women.
21748402 2011 A twin association study of nicotine dependence with markers in the CHRNA3 and CHRNA5 genes.
21747048 2011 Relationship between CYP2A6 and CHRNA5-CHRNA3-CHRNB4 variation and smoking behaviors and lung cancer risk.
21646606 2011 Nicotinic acetylcholine receptor polymorphism, smoking behavior, and tobacco-related cancer and lung and cardiovascular diseases: a cohort study.
21593077 2011 Genetic variation at CHRNA5-CHRNA3-CHRNB4 interacts with smoking status to influence body mass index.
21586512 2011 CHRNA5 as negative regulator of nicotine signaling in normal and cancer bronchial cells: effects on motility, migration and p63 expression.
21559498 2011 Chromosome 15q25 (CHRNA3-CHRNA5) variation impacts indirectly on lung cancer risk.
21448929 2011 Functionally significant nicotine acetylcholine receptor subunit ?5 promoter haplotypes are associated with susceptibility to lung cancer in Chinese.
21440309 2011 Association of FKBP5, COMT and CHRNA5 polymorphisms with PTSD among outpatients at risk for PTSD.
21436384 2011 Genetic variability of smoking persistence in African Americans.
21418140 2011 A CHRNA5 allele related to nicotine addiction and schizophrenia.
21385908 2011 Association of the nicotine metabolite ratio and CHRNA5/CHRNA3 polymorphisms with smoking rate among treatment-seeking smokers.
21321393 2011 Antibodies against extracellular domains of ?4 and ?7 subunits alter the levels of nicotinic receptors in the mouse brain and affect memory: possible relevance to Alzheimer's pathology.
21248747 2011 Association of a variant in the CHRNA5-A3-B4 gene cluster region to heavy smoking in the Italian population.
21228559 2011 An exploratory study on the CHRNA3-CHRNA5-CHRNB4 cluster, smoking, and Parkinson's disease.
21168125 2011 TTC12-ANKK1-DRD2 and CHRNA5-CHRNA3-CHRNB4 influence different pathways leading to smoking behavior from adolescence to mid-adulthood.
20886544 2010 Risk gene variants for nicotine dependence in the CHRNA5-CHRNA3-CHRNB4 cluster are associated with cognitive performance.
20881005 2011 Acetylcholine receptor (AChR) ?5 subunit variant associated with risk for nicotine dependence and lung cancer reduces (?4?2)??5 AChR function.
20854418 2011 CHRNB2 promoter region: association with subjective effects to nicotine and gene expression differences.
20840187 2010 Peer smoking and the nicotinic receptor genes: an examination of genetic and environmental risks for nicotine dependence.
20808433 2010 Associations of variants in CHRNA5/A3/B4 gene cluster with smoking behaviors in a Korean population.
20736995 2010 Resequencing of nicotinic acetylcholine receptor genes and association of common and rare variants with the Fagerström test for nicotine dependence.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20733116 2010 Promoter polymorphisms and transcript levels of nicotinic receptor CHRNA5.
20725741 2010 Nicotinic acetylcholine receptor genes on chromosome 15q25.1 are associated with nicotine and opioid dependence severity.
20700147 2011 Nicotinic ?5 receptor subunit mRNA expression is associated with distant 5' upstream polymorphisms.
20691427 2010 Genetic associations of brain structural networks in schizophrenia: a preliminary study.
20685379 2010 The nicotinic acetylcholine receptor CHRNA5/A3/B4 gene cluster: dual role in nicotine addiction and lung cancer.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20656943 2010 Loci identified by genome-wide association studies influence different disease-related phenotypes in chronic obstructive pulmonary disease.
20643934 2010 A genetically modulated, intrinsic cingulate circuit supports human nicotine addiction.
20631687 2010 Variation in the nicotinic acetylcholine receptor gene cluster CHRNA5-CHRNA3-CHRNB4 and its interaction with recent tobacco use influence cognitive flexibility.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20624154 2010 Incorporating age at onset of smoking into genetic models for nicotine dependence: evidence for interaction with multiple genes.
20587604 2010 Fine mapping of chromosome 15q25.1 lung cancer susceptibility in African-Americans.
20584212 2010 Multiple cholinergic nicotinic receptor genes affect nicotine dependence risk in African and European Americans.
20581870 2010 From smoking to lung cancer: the CHRNA5/A3/B4 connection.
20564069 2010 Mediating effects of smoking and chronic obstructive pulmonary disease on the relation between the CHRNA5-A3 genetic locus and lung cancer risk.
20554942 2010 Nicotinic acetylcholine receptor region on chromosome 15q25 and lung cancer risk among African Americans: a case-control study.
20548021 2010 Replication of lung cancer susceptibility loci at chromosomes 15q25, 5p15, and 6p21: a pooled analysis from the International Lung Cancer Consortium.
20485328 2010 Variation in nicotinic acetylcholine receptor genes is associated with multiple substance dependence phenotypes.
20438829 2010 Low ethanol concentration alters CHRNA5 RNA levels during early human development.
20418889 2010 Meta-analysis and imputation refines the association of 15q25 with smoking quantity.
20395203 2010 A second genetic variant on chromosome 15q24-25.1 associates with lung cancer.
20381163 2010 Large variability in smokers obscure the G x E effects on tobacco dependence.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
20173748 2010 Variants in FAM13A are associated with chronic obstructive pulmonary disease.
20124469 2010 ASCL1 regulates the expression of the CHRNA5/A3/B4 lung cancer susceptibility locus.
19955392 2010 Role of 5p15.33 (TERT-CLPTM1L), 6p21.33 and 15q25.1 (CHRNA5-CHRNA3) variation and lung cancer risk in never-smokers.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19859904 2010 Association and interaction analysis of variants in CHRNA5/CHRNA3/CHRNB4 gene cluster with nicotine dependence in African and European Americans.
19836008 2009 A genome-wide association study of lung cancer identifies a region of chromosome 5p15 associated with risk for adenocarcinoma.
19776245 2010 Association between a 15q25 gene variant, smoking quantity and tobacco-related cancers among 17 000 individuals.
19733931 2010 Blood-based CHRNA3 single nucleotide polymorphism and outcome in advanced non-small-cell lung cancer patients.
19706762 2009 The CHRNA5-CHRNA3-CHRNB4 nicotinic receptor subunit gene cluster affects risk for nicotine dependence in African-Americans and in European-Americans.
19696770 2009 Role of genetic variants in the CHRNA5-CHRNA3-CHRNB4 cluster in nicotine dependence risk: importance of gene-environment interplay.
19671882 2009 Natural variation within the neuronal nicotinic acetylcholine receptor cluster on human chromosome 15q24: influence on heritable autonomic traits in twin pairs.
19641473 2009 Racial differences in the association between SNPs on 15q25.1, smoking behavior, and risk of non-small cell lung cancer.
19628476 2009 Association of serum cotinine level with a cluster of three nicotinic acetylcholine receptor genes (CHRNA3/CHRNA5/CHRNB4) on chromosome 15.
19577767 2010 CHRNA5 gene D398N polymorphism in Japanese lung adenocarcinoma.
19482438 2009 Association of genes coding for the alpha-4, alpha-5, beta-2 and beta-3 subunits of nicotinic receptors with cigarette smoking and nicotine dependence.
19443489 2009 Risk for nicotine dependence and lung cancer is conferred by mRNA expression levels and amino acid change in CHRNA5.
19436041 2009 Human neuronal acetylcholine receptor A5-A3-B4 haplotypes are associated with multiple nicotine dependence phenotypes.
19429911 2009 A common genetic variant in the 15q24 nicotinic acetylcholine receptor gene cluster (CHRNA5-CHRNA3-CHRNB4) is associated with a reduced ability of women to quit smoking in pregnancy.
19390575 2009 Lung cancer susceptibility model based on age, family history and genetic variants.
19300482 2009 A genome-wide association study in chronic obstructive pulmonary disease (COPD): identification of two major susceptibility loci.
19259974 2009 Multiple distinct risk loci for nicotine dependence identified by dense coverage of the complete family of nicotinic receptor subunit (CHRN) genes.
19247474 2009 Genome-wide and candidate gene association study of cigarette smoking behaviors.
19223495 2009 Transcription deregulation at the 15q25 locus in association with lung adenocarcinoma risk.
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
19132693 2009 Variants in nicotinic acetylcholine receptors alpha5 and alpha3 increase risks to nicotine dependence.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19059502 2009 Design and expression of human alpha7 nicotinic acetylcholine receptor extracellular domain mutants with enhanced solubility and ligand-binding properties.
19029397 2008 Nicotinic receptor gene variants influence susceptibility to heavy smoking.
19010884 2008 Smokers with the CHRNA lung cancer-associated variants are exposed to higher levels of nicotine equivalents and a carcinogenic tobacco-specific nitrosamine.
19005185 2009 Contribution of nicotine acetylcholine receptor polymorphisms to lung cancer risk in a smoking-independent manner in the Japanese.
18996504 2009 Smoking cessation and variations in nicotinic acetylcholine receptor subunits alpha-5, alpha-3, and beta-4 genes.
18978134 2008 Lung cancer gene associated with COPD: triple whammy or possible confounding effect?
18957677 2008 The CHRNA5-A3 region on chromosome 15q24-25.1 is a risk factor both for nicotine dependence and for lung cancer.
18783506 2008 Association of a single nucleotide polymorphism in neuronal acetylcholine receptor subunit alpha 5 (CHRNA5) with smoking status and with 'pleasurable buzz' during early experimentation with smoking.
18780872 2008 Familial aggregation of common sequence variants on 15q24-25.1 in lung cancer.
18759969 2008 In search of causal variants: refining disease association signals using cross-population contrasts.
18618000 2008 A candidate gene approach identifies the CHRNA5-A3-B4 region as a risk factor for age-dependent nicotine addiction.
18559515 2008 Activated cholinergic signaling provides a target in squamous cell lung carcinoma.
18519524 2008 Variants in nicotinic receptors and risk for nicotine dependence.
18519132 2008 A risk allele for nicotine dependence in CHRNA5 is a protective allele for cocaine dependence.
18450646 2008 Receptor-mediated tobacco toxicity: acceleration of sequential expression of alpha5 and alpha7 nicotinic receptor subunits in oral keratinocytes exposed to cigarette smoke.
18414406 2009 Genetic variation in the CHRNA5 gene affects mRNA levels and is associated with risk for alcohol dependence.
18385739 2008 A variant associated with nicotine dependence, lung cancer and peripheral arterial disease.
18385738 2008 A susceptibility locus for lung cancer maps to nicotinic acetylcholine receptor subunit genes on 15q25.
18385720 2008 Genomics: when the smoke clears ...
18385676 2008 Genome-wide association scan of tag SNPs identifies a susceptibility locus for lung cancer at 15q25.1.
18227835 2008 Alpha-5/alpha-3 nicotinic receptor subunit alleles increase risk for heavy smoking.
18165968 2008 Identification of pharmacogenetic markers in smoking cessation therapy.
18163978 2008 The CHRNA5/A3/B4 gene cluster variability as an important determinant of early alcohol and tobacco initiation in young adults.
17559419 2008 Why do young women smoke? V. Role of direct and interactive effects of nicotinic cholinergic receptor gene variation on neurocognitive function.
17373692 2007 No evidence for association between 19 cholinergic genes and bipolar disorder.
17135278 2007 Cholinergic nicotinic receptor genes implicated in a nicotine dependence association study targeting 348 candidate genes with 3713 SNPs.
16341674 2005 Transcriptome analysis of human gastric cancer.
15716100 2005 In vivo RNA-RNA duplexes from human alpha3 and alpha5 nicotinic receptor subunit mRNAs.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12783266 2003 Nicotinic acetylcholine receptors: from structure to brain function.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11606319 2001 Formation of functional alpha3beta4alpha5 human neuronal nicotinic receptors in Xenopus oocytes: a reporter mutation approach.
10679230 2000 Nicotine binding to native and substituted peptides comprising residues 188-207 of nicotinic acetylcholine receptor alpha1, alpha2, alpha3, alpha4, alpha5, and alpha7 subunits.
9655874 1998 alpha 5 Subunit alters desensitization, pharmacology, Ca++ permeability and Ca++ modulation of human neuronal alpha 3 nicotinic receptors.
9193799 1997 Expression of the alpha 7 subunit of the nicotinic acetylcholine receptor in normal and myasthenic human thymuses.
9009220 1997 Cloning and sequence of full-length cDNAs encoding the human neuronal nicotinic acetylcholine receptor (nAChR) subunits beta3 and beta4 and expression of seven nAChR subunits in the human neuroblastoma cell line SH-SY5Y and/or IMR-32.
8906617 1996 Comparative structure of human neuronal alpha 2-alpha 7 and beta 2-beta 4 nicotinic acetylcholine receptor subunits and functional expression of the alpha 2, alpha 3, alpha 4, alpha 7, beta 2, and beta 4 subunits.
8663494 1996 Assembly of human neuronal nicotinic receptor alpha5 subunits with alpha3, beta2, and beta4 subunits.
2004777 1991 Mapping of multiple subunits of the neuronal nicotinic acetylcholine receptor to chromosome 15 in man and chromosome 9 in mouse.
1572664 1992 Chromosomal localization and physical linkage of the genes encoding the human alpha 3, alpha 5, and beta 4 neuronal nicotinic receptor subunits.
1542648 1992 Neuronal-type alpha-bungarotoxin receptors and the alpha 5-nicotinic receptor subunit gene are expressed in neuronal and nonneuronal human cell lines.
1505988 1992 Chromosomal localization of seven neuronal nicotinic acetylcholine receptor subunit genes in humans.