Property Summary

NCBI Gene PubMed Count 195
PubMed Score 87.19
PubTator Score 110.74

Knowledge Summary

Patent (2,328)

Expression

  Differential Expression (11)

Disease log2 FC p
posterior fossa group B ependymoma -1.700 1.2e-04
glioblastoma -1.400 2.0e-04
medulloblastoma, large-cell 1.100 9.7e-03
lung cancer 4.600 4.4e-06
colon cancer -2.700 3.5e-02
pediatric high grade glioma -1.100 3.9e-03
group 3 medulloblastoma -1.500 3.4e-02
pilocytic astrocytoma -1.700 7.7e-05
subependymal giant cell astrocytoma -1.105 1.4e-02
lung carcinoma 1.700 5.0e-15
psoriasis 1.300 1.1e-24

 CSPA Cell Line (1)

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
1788 other 0 / 0 / 0 Discovery of novel allosteric modulators of the M1 muscarinic receptor: Agonist Ancillary Activity
1921 other 2 / 0 / 0 Discovery of a Highly Selective in vitro and in vivo M4 Positive Allosteric Modulator: Ancillary Activity
434974 screening 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen

Gene RIF (170)

PMID Text
26942719 two SNPs (rs6495308 and rs11072768) in CHRNA5-A3-B4 have a indirect effect on lung cancer through smoking behaviors
26689306 Our data suggest that gene variance in the CHRNA5-CHRNA3-CHRNB4 cluster is associated with an increased risk of death, incidence of COPD and tobacco-related cancer in smokers.
26527870 CHRNA3 - candidate gene for Chronic Obstructive Pulmonary Disease identified by Genome-wide association studies.
26010901 Data suggest that CHRNA5-A3-B4 gene variants do not exhibit a robust association with smoking cessation and are unlikely to be useful for clinically optimizing smoking cessation pharmacotherapy for Caucasian smokers.
26002565 Of the 2305 SNPs identified in the CHRNA3 gene, 115 were found to be non-synonymous and 12 and 15 nsSNPs were found to be in the 5' and 3' UTRs, respectively. 115 nsSNPs investigated, eight were predicted to be deleterious by both SIFT and PredictSNP servers.
25874685 The positive interaction between heavy smoking and the homozygous mutant CHRNA3 rs6495308 genotype was found to affect the likelihood of hypertension in Chinese male smokers.
25656608 the haplotype analysis found that the haplotypes "TCAC" and "CTGT," composed of rs938682, rs12914385, rs11637630, and rs2869546, were associated with a 1.79-fold and 501-fold increased lung cancer risk
25474695 CHRNA5-A3-B4 genotype associates with body mass index in never smokers.
25399010 The frequencies of genotype and allele in CHRNA3 (rs8040868) and PHACTR2 (rs9390123) were not significantly different between the NSCLC cases and controls, or between either of the subgroups.
25384568 Study provides new evidence that the overexpression of the CHRNA5/A3/B4 region disrupts pyramidal neuronal structure in the hippocampus, and thus affecting the cognitive capacities
25297392 Suggest no relationship between these smoking-related SNPs in the CHRNA5/A3/B4 gene cluster and psoriasis vulgaris in Chinese Han population.
25293386 In Mendelian randomisation analyses, there was no strong evidence that the minor allele of rs16969968/rs1051730 was associated with depression, anxiety or psychological distress in current or former smokers. [Meta-analysis]
25288178 Our findings demonstrated that CHRNA3 gene rs6495309 polymorphism might be a risk factor for the development of lung cancer in Chinese.
25270189 Elucidation of the signaling events elicited upon agonist binding to corneal mAChRs and nAChRs will be crucial for understanding the mechanisms of ACh signaling in CECs, which has salient clinical implications.
25051068 Four SNPs in the CHRNA3/5 locus are associated with chronic obstructive pulmonary disease risk. [Meta-analysis]
24906368 High cumulative tobacco consumption is associated with short telomeres observationally, but there is no clear genetic association.
24750073 The alpha3beta4* nicotinic ACh receptor subtype mediates physical dependence to morphine
24719457 Increased expression of NeuroD1 subsequently leads to regulation of expression and function of the nicotinic acetylcholine receptor subunit cluster of alpha3, alpha5, and beta4.
24686516 CHRNA3 polymorphism functions as a genetic modifier of the risk of developing lung ADC in the Chinese population, particularly in nonsmoking females.
24588897 Investigated associations between neuroticism and 13 SNPs in the CHRNA5 and CHRNA3 genes in young adult Mexican American men and women.
24535486 Results show that CHRNA3 genotype is associated with decreased lung function and risk of chronic obstructive pulmonary disease. among ever-smokers, whereas this was not the case for CYP3A5*3.
24375168 The minor alleles of two polymorphisms (rs578776 and rs3743078) in the CHRNA3 gene are associated with an increased risk of tobacco smoking only among patients with ADHD.
24337855 rs1051730 polymorphism may modify susceptibility to lung cancer via a smoking-independent manner among Chinese Han population.
24113126 GABRR2 and CHRNA3 were found to be differentially expressed after risperidone treatment. These genes may be regulated by antipsychotic use.
24057674 Rare missense variants in CHRNB3 and CHRNA3 are associated with risk of alcohol and cocaine dependence.
23884938 Our findings uncover a novel mechanism of nicotine-induced alpha3beta4 nAChR upregulation that may be relevant also for other nAChR subtypes.
23844051 CHRNA5-A3-B4 rs667282 TT/TG genotypes were associated with significantly increased risk of esophageal squamous cell carcinoma.
23729684 SNP rs1051730 associated with smoking and body mass index
23710919 silencing alpha3 nAChR mRNA might enhance the effect of Abeta25-35 on cell apoptosis by increasing the levels of p38 protein and bax mRNA and decreasing the level of bcl-2 mRNA, which may play a role in the pathogenesis of Alzheimer's disease
23701534 we evaluate the utility of genetic variants in CHRNA3 for smoking as a risk factor in low birth weight
23692359 Genetic variants in the CHRNA5-A3-B4 gene cluster alter nicotine intake and body mass index in a population of Alaska Native people, who have a distinct haplotype structure, smoking behaviors and prevalence of obesity.
23689675 study identified an association between a nicotinic acetylcholine receptor a3 subunit variant (rs578776)and reward-related neural response in a large cohort of healthy non-smoking adolescents.
23626818 Cell surface localization of alpha3beta4 nicotinic acetylcholine receptors is regulated by N-cadherin homotypic binding and actomyosin contractility.
23604333 Genetic variation in nicotinic receptor gene CHRNA3 might be an important connecting link between early attentional processes and smoking behavior.
23458267 Rare genetic variation in the CHRNA5-A3-B4 gene cluster contributes modestly to the level of response to alcohol.
23255854 The rs6495309 CT, or TT genotype of nicotinic acetylcholine receptor alpha subunit 3(CHRNA3) was associated with a significantly decreased risk of moderate to very severe chronic obstructive pulmonary disease.
23207642 Genetic variations in CHRNA3 are associated with COPD in the Korean population.
23143843 Genetic variation in the CHRNA5-CHRNA3-CHRNB4 gene cluster, encoding the alpha5, alpha3, and beta4 nAChR subunits, respectively, has been shown to increase vulnerability to tobacco dependence.
23061658 The subjects carrying the minor "A" allele on rs1051730 in CHRNA3 may be at risk to develop COPD and/or lung cancer as well as nicotine-dependence.
23056235 Data show a statistical association and suggest biological plausibility that the CHRNA3 rs6495309T>C polymorphism contributed to increased risks and poor prognosis of both COPD and lung cancer.
23029550 Associations between variation in CHRNA5-CHRNA3-CHRNB4, body mass index and blood pressure in smokers and non-smokers.
23023782 CHRNA3 gene rs3743073G variant genotype significantly increased lung cancer risk, especially in male smokers over the age of 60.
22956269 Genetic variation in the 15q25 nicotinic acetylcholine receptor gene cluster (CHRNA5-CHRNA3-CHRNB4) interacts with maternal self-reported smoking status during pregnancy to influence birth weight.
22914670 CHRNA3 polymorphism was associated with pack-year of smoking in chronic obstructive pulmonary disease Chinese Han patients
22837378 Results suggest important role for CHRNA3 variants as genetic risk factor for airflow obstruction that may be independent of smoking status.
22722785 CHRNA3 polymorphism on chromosome 15q25 is associated with early stage non-small-cell lung cancer.
22701590 CHRNA3 gene rs1051730-A allele might be a risk-conferring factor for the development of lung cancer in Caucasians, but not in East-Asians.
22461431 A replication of association between two SNPs previously associated with COPD (CHRNA3/5 and IREB2), as well as an association with COPD of one locus initially associated with lung function (ADCY2).
22459873 transgenic mice with human alpha 5, alpha 3, beta 4 subunit genes drank less ethanol than wild-type in a two-bottle (ethanol vs. water) preference test; results suggest a complex role for this receptor subunit gene cluster in the modulation of ethanol's as well as nicotine's effects
22441734 analysis of CHRNA3 genotype, nicotine dependence, lung function and disease in the general population
22382757 study provides evidence for a general role of the CHRNA5/A3/B4 gene cluster in substance use initiation that is not limited to nicotine and alcohol.
22356581 The data showed that IREB2 and CHRNA3 are potential genetic modifiers of chronic obstructive pulmonary disease in individuals with severe alpha-1 antitrypsin deficiency and may be sex-specific in their impact.
22336398 The genetic risks of nicotine dependence associated with the CHRNA5-A3-B4 subunit genes are specific, and not shared among commonly comorbid psychiatric disorders
22280835 Thia case-control analysis revealed that an increased risk of lung cancer is associated with an SNP in CHRNA3, rs8040868.
22274960 Expression of alpha-3 neuronal nicotinic acetylcholine receptor subunit in sympathetic ganglia remains stable after brain death and determines the feasibility of sympathetic thoracic ganglia as a study group.
22241830 Genetic variation within the CHRNA5-CHRNA3-CHRNB4 gene cluster is associated with nicotine dependence.
22223462 Single nucleotide polymorphisms in CHRNA3 gene is associated with nicotine dependence.
22101982 vivo evidence of the involvement of the CHRNA5, CHRNA3 and CHRNB4 genomic cluster in nicotine addiction
22042234 This study examines whether the CHRNA5/CHRNA3/CHRNB4 locus is correlated also with externalizing behaviors in three independent longitudinally assessed adolescent samples
22024278 The involvement of alpha3/alpha5/beta4 nicotinic receptor subunit is determined in working memory and impulsivity, two behavioral traits that could promote development of nicotine dependence.
22017462 An interaction between tobacco smoke exposure and a CHRNA3/5 polymorphism was found for BHR in children, but CHRNA3/5 was not associated with asthma or lung function.
21858091 Data show that luciferase expression was equivalent among CHRNA3 haplotypes, but the combination of deletion at rs3841324 and variation at rs503464 decreased CHRNA5 promoter-derived luciferase activity.
21810735 Women with the variant AA genotype of CHRNA3 rs578775 were at significantly decreased risk of heavy smoking.
21765098 No association was found for CHRNA3 SNPs in relation to adolescent smoking behavior.
21748402 CHRNA3 and CHRNA5 have roles in different forms of tobacco dependence, but the specific genetic variants do not account for much fo the total genetic variance for predisposition to nicotine dependence
21747048 Variation in CHRNA5-A3-B4 was independently and additively associated with increased smoking, nicotine dependence, and lung cancer risk.
21690317 A weak effect of CHRNA3 rs1051730 genetic variation is observed on short-term smoking cessation.
21646606 Nicotinic acetylcholine receptor polymorphisms are associated with additional increased risk of lung cancer, bladder cancer, and chronic obstructive pulmonary disease after adjustment for smoking.
21623257 Polymorphisms in CHRNA3 gene is associated with lung squamous cell carcinoma.
21593077 Common variation in the CHRNA5-CHRNA3-CHRNB4 gene region (chromosome 15q25) IS ASSOCIATED WITH SMOKING QUANTITY AND THE GENOTYPE MAY BE associated with BMI in smokers
21559498 CHRNA3-CHRNA5 variation impacts indirectly on lung cancer risk
21536845 Sympathetic alpha3beta2-nAChRs mediate basilar artery neurogenic nitrergic vasodilation in swine.
21511889 Data confirm the effect of variant within the promoter region of the CHRNA3 gene on nicotine dependence but failed to find any relationship with difficulty, willingness, and motivation to quit.
21486776 The A2A receptor reduces the desensitization of alpha3beta4 nAChR through the action of protein kinase A. Mutations disrupting the sequence 385RAES388 abolish PKA-induced changes in nAChR function.
21436384 Single Nucleotide Polymorphisms in CHRNA3 is associated with smoking persistence in African Americans.
21385908 This study demonstrates the additive and independent association of the nicotine metabolite ratio and SNPs in the CHRNA5/A3/B4 gene cluster with smoking rate in treatment-seeking smokers.
21312287 none of the COMT SNPs were associated directly with nicotine dependence (ND); the interaction of intronic COMT SNP, rs9332377, with CHRNA3 3'UTR SNP rs660652 was significantly associated with ND
21248747 Variant A of the rs1051730 SNP of CHRNA5-A3-B4 gene cluster was significantly associated with smoking quantity in 2 Italian populations, Val Borbera and Cilento, no association was found in Carlantino population.
21228559 Single nucleotide polymorphism (SNP) CHRNA3 on chromosome 15 is not associated with Parkinson's disease risk in the overall anaylsis or after stratifying on smoking status.
21168125 CHRNA5-CHRNA3-CHRNB4 is involved in the transition toward heavy smoking in mid-adulthood and in smoking persistence.
21081471 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20886544 evidence that CHRNA5-CHRNA3-CHRNB4 gene cluster variants,particularly CHRNA5 variant rs16969968, could be associated with cognitive performance possibly mediating in part risk for developing nicotine dependence
20886544 Observational study of gene-disease association. (HuGE Navigator)
20840187 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20808433 associations of variants in the CHRNA5/A3/B4 cluster with smoking initiation, smoking quantity and smoking cessation
20808433 Observational study of gene-disease association. (HuGE Navigator)
20736995 Observational study of gene-disease association. (HuGE Navigator)
20734064 Observational study of gene-disease association. (HuGE Navigator)
20725741 Observational study of gene-disease association. (HuGE Navigator)
20712524 Clinical trial of gene-disease association. (HuGE Navigator)
20685379 This review focuses on the clustered nicotinic acetylcholine receptor genes CHRNalpha5/alpha3/beta4 and evaluates their role in nicotine addiction and lung cancer.
20656943 The CHRNA3/5 locus was associated with increased smoking intensity and emphysema in individuals with COPD
20656943 Observational study of gene-disease association. (HuGE Navigator)
20643934 findings suggest that both CHNA5 Asp398Asn and CHRNA3 rs578776 are associated with smoking.
20643934 Observational study of gene-disease association. (HuGE Navigator)
20631687 Variation in the nicotinic acetylcholine receptor gene cluster CHRNA5-CHRNA3-CHRNB4 influences cognitive flexibility differently in African Americans compared to European Americans.
20631687 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20587604 Observational study of gene-disease association. (HuGE Navigator)
20584212 Observational study of gene-disease association. (HuGE Navigator)
20564069 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20554942 Observational study of gene-disease association. (HuGE Navigator)
20485328 The data of this study supported the importance of variants in the CHRNA5/A3/B4 gene cluster as mediators of the genetic risk for substance dependence.
20485328 Observational study of gene-disease association. (HuGE Navigator)
20426799 Data suggest that interactions between alpha3beta4 nAChRs and P2X2 receptors may modulate transmission at enteric synapses that use ATP and acetylcholine as co-transmitters.
20418890 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20418889 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20395203 Observational study of gene-disease association. (HuGE Navigator)
20393456 These results suggest that sensorimotor gating is influenced by variations of the CHRNA3 gene, which might also have an impact on the course and severity of schizophrenia.
20393456 Observational study of gene-disease association. (HuGE Navigator)
20234319 Single nucleotide polymorphisms in the CHRNA3 gene is associated with lung cancer.
20234319 Observational study of gene-disease association. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20068085 Observational study of gene-disease association. (HuGE Navigator)
20043866 Loop 9 has a different role in the function of homomeric and heteromeric receptors.
20007924 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19955392 Observational study of gene-disease association. (HuGE Navigator)
19859904 These results indicate that variants within CHRNA3 and among CHRNA5, CHRNA3, and CHRNB4 contribute significantly to the etiology of ND through gene-gene interactions.
19859904 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19834535 Observational study of gene-disease association. (HuGE Navigator)
19733931 single nucleotide polymorphisms influence treatment outcome in advanced non-small-cell lung cancer patients
19733931 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19706762 The CHRNA3 SNP rs578776 is associated with nicotine dependence in European-Americans but not in African-Americans
19706762 Observational study of gene-disease association. (HuGE Navigator)
19696770 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19671882 Observational study of gene-disease association. (HuGE Navigator)
19641473 Single Nucleotide Polymorphism in CHRNA3 is associated with non-small cell lung cancer.
19641473 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19628476 Genetic variation at CHRNA5/CHRNA3/CHRNB4 cluster influences blood nicotine level.
19628476 Observational study of gene-disease association. (HuGE Navigator)
19628475 Missense mutation of CHRNB4, CHRNB3 and CHRNA4 are associated with sporadic amyotrophic lateral sclerosis.
19628475 Observational study of gene-disease association. (HuGE Navigator)
19506133 The detection of alpha3-AChR autoantibody aids the diagnosis of neurological autoimmunity and cancer.
19429911 Genetic variant in the CHRNA5-CHRNA3-CHRNB4 gene cluster is associated with smoking cessation during pregnancy.
19429911 Observational study of gene-disease association. (HuGE Navigator)
19300482 The CHRNA 3/5 and the HHIP loci make a significant contribution to the risk of COPD.
19300482 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19259974 Observational study of gene-disease association. (HuGE Navigator)
19247474 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19132693 The alpha5 and alpha3 subunits play a significant role in both nicotine dependence and alcohol abuse/dependence.
19132693 Observational study of gene-disease association. (HuGE Navigator)
19029397 Two distinct variant groups in the CHRNA5-CHRNA3-CHRNB4 gene cluster are strongly associated with heavy smoking. The snp rs16969968 alters the coding sequence of these genes.
19029397 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19010884 smokers who carry the CHRNA3 and CHRNA5 variants are expected to be at increased risk for lung cancer compared with smokers who do not carry these alleles.
19005185 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18996504 CHRNA3 seem to exert no relevant influence on smoking cessation probability in heavy smokers in the general population.
18996504 Observational study of gene-disease association. (HuGE Navigator)
18957677 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18780872 Observational study of gene-disease association. (HuGE Navigator)
18759969 Correlated SNPs in the cholinergic nicotinic receptor gene cluster CHRNA5-CHRNA3-CHRNB4, in a case-control study of cocaine dependence composed of 504 European-American and 583 African-Americans.
18647633 alpha3 nAChR may improve cleavage of APP by alpha-secretase, enhance antioxidation and inhibit the toxicity of Abeta, suggesting that the receptor might play an important role in AD.
18618000 In the 2,827 long-term smokers examined, common susceptibility and protective haplotypes at the CHRNA5-A3-B4 locus were associated with nicotine dependence severity.
18519524 Observational study of gene-disease association. (HuGE Navigator)
18414406 Observational study of gene-disease association. (HuGE Navigator)
18385738 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18385676 CHRNA5 and CHRNA3 are promising candidate genes in the region of 15q25.1 for lung cancer.
18385676 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18227835 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18227835 A common haplotype in the CHRNA5/CHRNA3 gene cluster on chromosome 15 contains alleles, which predispose to nicotine dependence.
18163978 Observational study of gene-disease association. (HuGE Navigator)
17504758 Reporter gene analysis demonstrated that this sequence, termed "alpha3 intron 5," inhibits the transcriptional activities of the alpha3 and beta4 subunit gene promoters
17373692 Observational study of gene-disease association. (HuGE Navigator)
17344216 the alpha3 subunit is expressed in every terminally differentiated ganglionic cell, this is the first example of a "pan-autonomic" gene whose expression is regulated by PHOX2 proteins.
15681842 alpha3beta2 nicotinic receptor has a role in regulating gene expression after tobacco exposure in oral epithelial cells
15494367 alpha3 and alpha7 nicotinic acetylcholine receptors regulate keratinocyte chemokinesis and chemotaxis
12912995 absence of differences in the pharmacological profile of nicotinic receptor alpha3beta4 argues against role for incorporated beta3 subunit in formation of agonist binding sites while changes in channel kinetics suggest important effect on receptor gating
12663058 CHRNA3 subunit is expressed in the soma of the majority of pyramidal cells, with the most alpha 3 immunoreactivity observed in CA2-4 and entorhinal cortex and relatively less in CA1 and subicular pyramidal cell soma.
12214130 Observational study of gene-disease association. (HuGE Navigator)
12214130 CHRNA3 and CHRNA4 genes and AD. Two novel missense point mutations, Ser413Leu in the CHRNA4 gene and Gln397Pro in the CHRNB2 gene, were identified in two different AD cases but were not found in other AD cases and controls.
11771745 Changes in nicotinic acetylcholine receptor subunits expression in brain of patients with Down syndrome and Alzheimer's disease.

AA Sequence

MGSGPLSLPLALSPPRLLLLLLLSLLPVARASEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQ      1 - 70
LVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKAL     71 - 140
LKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGEWAII    141 - 210
KAPGYKHDIKYNCCEEIYPDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVL    211 - 280
LSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPSWVKTVFLNLL    281 - 350
PRVMFMTRPTSNEGNAQKPRPLYGAELSNLNCFSRAESKGCKEGYPCQDGMCGYCHHRRIKISNFSANLT    351 - 420
RSSSSESVDAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQDDWKYVAMVIDRIFLWVFTLVCILG    421 - 490
TAGLFLQPLMAREDA                                                           491 - 505
//

Text Mined References (198)

PMID Year Title
26942719 2016 Chromosome 15q25 (CHRNA3-CHRNB4) Variation Indirectly Impacts Lung Cancer Risk in Chinese Males.
26689306 2016 Gene variance in the nicotinic receptor cluster (CHRNA5-CHRNA3-CHRNB4) predicts death from cardiopulmonary disease and cancer in smokers.
26527870 2015 Candidate genes for COPD: current evidence and research.
26010901 2015 Lack of Associations of CHRNA5-A3-B4 Genetic Variants with Smoking Cessation Treatment Outcomes in Caucasian Smokers despite Associations with Baseline Smoking.
26002565 2015 Identification of Deleterious SNPs and Their Effects on Structural Level in CHRNA3 Gene.
25874685 2015 CHRNA3 rs6495308 genotype as an effect modifier of the association between daily cigarette consumption and hypertension in Chinese male smokers.
25656608 2015 CHRNA3 genetic polymorphism and the risk of lung cancer in the Chinese Han smoking population.
25474695 2014 Stratification by smoking status reveals an association of CHRNA5-A3-B4 genotype with body mass index in never smokers.
25399010 2014 Association between polymorphisms in CHRNA3 and PHACTR2 gene and environment and NSCLC risk in Chinese population.
25384568 2014 Hippocampal changes produced by overexpression of the human CHRNA5/A3/B4 gene cluster may underlie cognitive deficits rescued by nicotine in transgenic mice.
25297392 2014 An association study on the CHRNA5/A3/B4 gene cluster, smoking and psoriasis vulgaris.
25293386 2014 Investigating the possible causal association of smoking with depression and anxiety using Mendelian randomisation meta-analysis: the CARTA consortium.
25288178 2014 The association between the rs6495309 polymorphism in CHRNA3 gene and lung cancer risk in Chinese: a meta-analysis.
25270189 2014 The acetylcholine signaling network of corneal epithelium and its role in regulation of random and directional migration of corneal epithelial cells.
25241909 2014 Genetic susceptibility for chronic bronchitis in chronic obstructive pulmonary disease.
25101718 2015 IREB2 and GALC are associated with pulmonary artery enlargement in chronic obstructive pulmonary disease.
25072098 2014 Beyond cigarettes per day. A genome-wide association study of the biomarker carbon monoxide.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
25051068 2014 Four SNPs in the CHRNA3/5 alpha-neuronal nicotinic acetylcholine receptor subunit locus are associated with COPD risk based on meta-analyses.
25006744 2014 Genome-wide association identifies regulatory Loci associated with distinct local histogram emphysema patterns.
24906368 2014 High tobacco consumption is causally associated with increased all-cause mortality in a general population sample of 55,568 individuals, but not with short telomeres: a Mendelian randomization study.
24750073 2014 The ?3?4* nicotinic ACh receptor subtype mediates physical dependence to morphine: mouse and human studies.
24719457 2014 NeuroD1 mediates nicotine-induced migration and invasion via regulation of the nicotinic acetylcholine receptor subunits in a subset of neural and neuroendocrine carcinomas.
24686516 2014 CHRNA3 polymorphism modifies lung adenocarcinoma risk in the Chinese Han population.
24621683 2014 Risk loci for chronic obstructive pulmonary disease: a genome-wide association study and meta-analysis.
24588897 2014 CHRNA5 and CHRNA3 variants and level of neuroticism in young adult Mexican American men and women.
24535486 2014 CHRNA3 and CYP3A5*3 genotype, lung function and chronic obstructive pulmonary disease in the general population.
24375168 2014 ADHD diagnosis may influence the association between polymorphisms in nicotinic acetylcholine receptor genes and tobacco smoking.
24337855 2013 Association between CHRNA3 rs1051730 genotype and lung cancer risk in Chinese Han population: a case-control study.
24113126 2013 Neurotransmitter receptor and regulatory gene expression in peripheral blood of Brazilian drug-naïve first-episode psychosis patients before and after antipsychotic treatment.
24057674 2014 Rare missense variants in CHRNB3 and CHRNA3 are associated with risk of alcohol and cocaine dependence.
23884938 2013 Nicotine-modulated subunit stoichiometry affects stability and trafficking of ?3?4 nicotinic receptor.
23844051 2013 Association of CHRNA5-A3-B4 variation with esophageal squamous cell carcinoma risk and smoking behaviors in a Chinese population.
23729684 2013 Smoking status, snus use, and variation at the CHRNA5-CHRNA3-CHRNB4 locus in relation to obesity: the GLACIER study.
23710919 2013 [Effects of ?3 neuronal nicotinic acetylcholine receptor on cell apoptosis and p38 MAPK signal transduction pathway in SH-SY5Y cells].
23701534 2013 Genetic instrumental variable studies of effects of prenatal risk factors.
23692359 2013 CHRNA5-A3-B4 genetic variants alter nicotine intake and interact with tobacco use to influence body weight in Alaska Native tobacco users.
23689675 2013 Genetic risk for nicotine dependence in the cholinergic system and activation of the brain reward system in healthy adolescents.
23626818 2013 Cell surface localization of ?3?4 nicotinic acetylcholine receptors is regulated by N-cadherin homotypic binding and actomyosin contractility.
23604333 2013 The effect of nicotine on sensorimotor gating is modulated by a CHRNA3 polymorphism.
23458267 2013 Examination of rare missense variants in the CHRNA5-A3-B4 gene cluster to level of response to alcohol in the San Diego Sibling Pair study.
23284291 2012 Genome-wide joint meta-analysis of SNP and SNP-by-smoking interaction identifies novel loci for pulmonary function.
23255854 2012 A functional polymorphism in the CHRNA3 gene and risk of chronic obstructive pulmonary disease in a Korean population.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23207642 2013 CHRNA3 variant for lung cancer is associated with chronic obstructive pulmonary disease in Korea.
23143843 2013 Molecular mechanisms underlying behaviors related to nicotine addiction.
23061658 2012 Role of CHRNA5-A3 genetic Locus variants and developing drug for chronic obstructive pulmonary disease.
23056235 2012 Functional polymorphisms of CHRNA3 predict risks of chronic obstructive pulmonary disease and lung cancer in Chinese.
23029550 2012 Associations between variation in CHRNA5-CHRNA3-CHRNB4, body mass index and blood pressure in the Northern Finland Birth Cohort 1966.
23023782 2012 Correlation between polymorphisms of nicotine acetylcholine acceptor subunit CHRNA3 and lung cancer susceptibility.
23022100 2012 Discovery and fine mapping of serum protein loci through transethnic meta-analysis.
22956269 2012 Genetic variation in the 15q25 nicotinic acetylcholine receptor gene cluster (CHRNA5-CHRNA3-CHRNB4) interacts with maternal self-reported smoking status during pregnancy to influence birth weight.
22914670 2012 Association of IREB2 and CHRNA3/5 polymorphisms with COPD and COPD-related phenotypes in a Chinese Han population.
22837378 2012 Genome-wide association studies identify CHRNA5/3 and HTR4 in the development of airflow obstruction.
22722785 2012 A functional polymorphism on chromosome 15q25 associated with survival of early stage non-small-cell lung cancer.
22701590 2012 Strong association between two polymorphisms on 15q25.1 and lung cancer risk: a meta-analysis.
22461431 2012 CHRNA3/5, IREB2, and ADCY2 are associated with severe chronic obstructive pulmonary disease in Poland.
22459873 2012 Transgenic over expression of nicotinic receptor alpha 5, alpha 3, and beta 4 subunit genes reduces ethanol intake in mice.
22441734 2012 CHRNA3 genotype, nicotine dependence, lung function and disease in the general population.
22382757 2012 The CHRNA5/A3/B4 gene cluster and tobacco, alcohol, cannabis, inhalants and other substance use initiation: replication and new findings using mixture analyses.
22356581 2012 Association of IREB2 and CHRNA3 polymorphisms with airflow obstruction in severe alpha-1 antitrypsin deficiency.
22336398 2012 Nicotine dependence and comorbid psychiatric disorders: examination of specific genetic variants in the CHRNA5-A3-B4 nicotinic receptor genes.
22280835 2012 New associations of the genetic polymorphisms in nicotinic receptor genes with the risk of lung cancer.
22274960 2012 Preservation of ?-3 neuronal nicotinic acetylcholine receptor expression in sympathetic ganglia after brain death.
22241830 2012 Analysis of detailed phenotype profiles reveals CHRNA5-CHRNA3-CHRNB4 gene cluster association with several nicotine dependence traits.
22223462 2012 Alpha-5 and -3 nicotinic receptor gene variants predict nicotine dependence but not cessation: findings from the COMMIT cohort.
22101982 2012 Overexpression of the CHRNA5/A3/B4 genomic cluster in mice increases the sensitivity to nicotine and modifies its reinforcing effects.
22080838 2012 A genome-wide association study of COPD identifies a susceptibility locus on chromosome 19q13.
22042234 2012 Externalizing behaviors are associated with SNPs in the CHRNA5/CHRNA3/CHRNB4 gene cluster.
22024278 2012 Overexpression of ?3/?5/?4 nicotinic receptor subunits modifies impulsive-like behavior.
22017462 2012 Alpha-nicotinic acetylcholine receptor and tobacco smoke exposure: effects on bronchial hyperresponsiveness in children.
21946350 2011 Genome-wide association and large-scale follow up identifies 16 new loci influencing lung function.
21858091 2011 In vitro and ex vivo analysis of CHRNA3 and CHRNA5 haplotype expression.
21810735 2011 Single nucleotide polymorphisms in CHRNA5 rs16969968, CHRNA3 rs578776, and LOC123688 rs8034191 are associated with heaviness of smoking in women in Northeastern Ontario, Canada.
21765098 2011 Combined analysis of CHRNA5, CHRNA3 and CYP2A6 in relation to adolescent smoking behaviour.
21748402 2011 A twin association study of nicotine dependence with markers in the CHRNA3 and CHRNA5 genes.
21747048 2011 Relationship between CYP2A6 and CHRNA5-CHRNA3-CHRNB4 variation and smoking behaviors and lung cancer risk.
21690317 2011 CHRNA3 rs1051730 genotype and short-term smoking cessation.
21646606 2011 Nicotinic acetylcholine receptor polymorphism, smoking behavior, and tobacco-related cancer and lung and cardiovascular diseases: a cohort study.
21623257 2011 Contribution of the TP53, OGG1, CHRNA3, and HLA-DQA1 genes to the risk for lung squamous cell carcinoma.
21593077 2011 Genetic variation at CHRNA5-CHRNA3-CHRNB4 interacts with smoking status to influence body mass index.
21559498 2011 Chromosome 15q25 (CHRNA3-CHRNA5) variation impacts indirectly on lung cancer risk.
21536845 2011 Sympathetic ????-nAChRs mediate cerebral neurogenic nitrergic vasodilation in the swine.
21511889 2011 Variant within the promoter region of the CHRNA3 gene associated with FTN dependence is not related to self-reported willingness to quit smoking.
21486776 2011 Adenosine A2A receptor induces protein kinase A-dependent functional modulation of human (alpha)3(beta)4 nicotinic receptor.
21436384 2011 Genetic variability of smoking persistence in African Americans.
21385908 2011 Association of the nicotine metabolite ratio and CHRNA5/CHRNA3 polymorphisms with smoking rate among treatment-seeking smokers.
21312287 2010 Why do young women smoke? VII COMT as a risk modifying gene for Nicotine dependence - role of gene-gene interaction, personality, and environmental factors.
21248747 2011 Association of a variant in the CHRNA5-A3-B4 gene cluster region to heavy smoking in the Italian population.
21228559 2011 An exploratory study on the CHRNA3-CHRNA5-CHRNB4 cluster, smoking, and Parkinson's disease.
21168125 2011 TTC12-ANKK1-DRD2 and CHRNA5-CHRNA3-CHRNB4 influence different pathways leading to smoking behavior from adolescence to mid-adulthood.
21081471 2011 Genetic variations on chromosomes 5p15 and 15q25 and bladder cancer risk: findings from the Los Angeles-Shanghai bladder case-control study.
20886544 2010 Risk gene variants for nicotine dependence in the CHRNA5-CHRNA3-CHRNB4 cluster are associated with cognitive performance.
20840187 2010 Peer smoking and the nicotinic receptor genes: an examination of genetic and environmental risks for nicotine dependence.
20808433 2010 Associations of variants in CHRNA5/A3/B4 gene cluster with smoking behaviors in a Korean population.
20736995 2010 Resequencing of nicotinic acetylcholine receptor genes and association of common and rare variants with the Fagerström test for nicotine dependence.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20725741 2010 Nicotinic acetylcholine receptor genes on chromosome 15q25.1 are associated with nicotine and opioid dependence severity.
20712524 2010 Genetic variation in three candidate genes and nicotine dependence, withdrawal and smoking cessation in hospitalized patients.
20685379 2010 The nicotinic acetylcholine receptor CHRNA5/A3/B4 gene cluster: dual role in nicotine addiction and lung cancer.
20656943 2010 Loci identified by genome-wide association studies influence different disease-related phenotypes in chronic obstructive pulmonary disease.
20643934 2010 A genetically modulated, intrinsic cingulate circuit supports human nicotine addiction.
20631687 2010 Variation in the nicotinic acetylcholine receptor gene cluster CHRNA5-CHRNA3-CHRNB4 and its interaction with recent tobacco use influence cognitive flexibility.
20587604 2010 Fine mapping of chromosome 15q25.1 lung cancer susceptibility in African-Americans.
20584212 2010 Multiple cholinergic nicotinic receptor genes affect nicotine dependence risk in African and European Americans.
20564069 2010 Mediating effects of smoking and chronic obstructive pulmonary disease on the relation between the CHRNA5-A3 genetic locus and lung cancer risk.
20554942 2010 Nicotinic acetylcholine receptor region on chromosome 15q25 and lung cancer risk among African Americans: a case-control study.
20485328 2010 Variation in nicotinic acetylcholine receptor genes is associated with multiple substance dependence phenotypes.
20438829 2010 Low ethanol concentration alters CHRNA5 RNA levels during early human development.
20426799 2010 Molecular mechanisms of cross-inhibition between nicotinic acetylcholine receptors and P2X receptors in myenteric neurons and HEK-293 cells.
20418890 2010 Genome-wide meta-analyses identify multiple loci associated with smoking behavior.
20418889 2010 Meta-analysis and imputation refines the association of 15q25 with smoking quantity.
20418888 2010 Sequence variants at CHRNB3-CHRNA6 and CYP2A6 affect smoking behavior.
20395203 2010 A second genetic variant on chromosome 15q24-25.1 associates with lung cancer.
20393456 2010 Sensorimotor gating is associated with CHRNA3 polymorphisms in schizophrenia and healthy volunteers.
20234319 2010 Association of the CHRNA3 locus with lung cancer risk and prognosis in Chinese Han population.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
20173748 2010 Variants in FAM13A are associated with chronic obstructive pulmonary disease.
20068085 2010 Analysis of genetic variants in never-smokers with lung cancer facilitated by an Internet-based blood collection protocol: a preliminary report.
20043866 2010 Role of loop 9 on the function of neuronal nicotinic receptors.
20007924 2010 The 15q24/25 susceptibility variant for lung cancer and chronic obstructive pulmonary disease is associated with emphysema.
19955392 2010 Role of 5p15.33 (TERT-CLPTM1L), 6p21.33 and 15q25.1 (CHRNA5-CHRNA3) variation and lung cancer risk in never-smokers.
19859904 2010 Association and interaction analysis of variants in CHRNA5/CHRNA3/CHRNB4 gene cluster with nicotine dependence in African and European Americans.
19836008 2009 A genome-wide association study of lung cancer identifies a region of chromosome 5p15 associated with risk for adenocarcinoma.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
19733931 2010 Blood-based CHRNA3 single nucleotide polymorphism and outcome in advanced non-small-cell lung cancer patients.
19706762 2009 The CHRNA5-CHRNA3-CHRNB4 nicotinic receptor subunit gene cluster affects risk for nicotine dependence in African-Americans and in European-Americans.
19696770 2009 Role of genetic variants in the CHRNA5-CHRNA3-CHRNB4 cluster in nicotine dependence risk: importance of gene-environment interplay.
19671882 2009 Natural variation within the neuronal nicotinic acetylcholine receptor cluster on human chromosome 15q24: influence on heritable autonomic traits in twin pairs.
19654303 2009 Deciphering the impact of common genetic variation on lung cancer risk: a genome-wide association study.
19641473 2009 Racial differences in the association between SNPs on 15q25.1, smoking behavior, and risk of non-small cell lung cancer.
19628476 2009 Association of serum cotinine level with a cluster of three nicotinic acetylcholine receptor genes (CHRNA3/CHRNA5/CHRNB4) on chromosome 15.
19628475 2009 Rare missense variants of neuronal nicotinic acetylcholine receptor altering receptor function are associated with sporadic amyotrophic lateral sclerosis.
19506133 2009 Ganglionic acetylcholine receptor autoantibody: oncological, neurological, and serological accompaniments.
19429911 2009 A common genetic variant in the 15q24 nicotinic acetylcholine receptor gene cluster (CHRNA5-CHRNA3-CHRNB4) is associated with a reduced ability of women to quit smoking in pregnancy.
19300482 2009 A genome-wide association study in chronic obstructive pulmonary disease (COPD): identification of two major susceptibility loci.
19259974 2009 Multiple distinct risk loci for nicotine dependence identified by dense coverage of the complete family of nicotinic receptor subunit (CHRN) genes.
19247474 2009 Genome-wide and candidate gene association study of cigarette smoking behaviors.
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
19132693 2009 Variants in nicotinic acetylcholine receptors alpha5 and alpha3 increase risks to nicotine dependence.
19059502 2009 Design and expression of human alpha7 nicotinic acetylcholine receptor extracellular domain mutants with enhanced solubility and ligand-binding properties.
19029397 2008 Nicotinic receptor gene variants influence susceptibility to heavy smoking.
19010884 2008 Smokers with the CHRNA lung cancer-associated variants are exposed to higher levels of nicotine equivalents and a carcinogenic tobacco-specific nitrosamine.
19005185 2009 Contribution of nicotine acetylcholine receptor polymorphisms to lung cancer risk in a smoking-independent manner in the Japanese.
18996504 2009 Smoking cessation and variations in nicotinic acetylcholine receptor subunits alpha-5, alpha-3, and beta-4 genes.
18978790 2008 Lung cancer susceptibility locus at 5p15.33.
18978787 2008 Common 5p15.33 and 6p21.33 variants influence lung cancer risk.
18957677 2008 The CHRNA5-A3 region on chromosome 15q24-25.1 is a risk factor both for nicotine dependence and for lung cancer.
18780872 2008 Familial aggregation of common sequence variants on 15q24-25.1 in lung cancer.
18759969 2008 In search of causal variants: refining disease association signals using cross-population contrasts.
18647633 2008 Inhibiting gene expression of alpha3 nicotinic receptor in SH-SY5Y cells with the effects on APP metabolism and antioxidation in Alzheimer's disease.
18618000 2008 A candidate gene approach identifies the CHRNA5-A3-B4 region as a risk factor for age-dependent nicotine addiction.
18519524 2008 Variants in nicotinic receptors and risk for nicotine dependence.
18414406 2009 Genetic variation in the CHRNA5 gene affects mRNA levels and is associated with risk for alcohol dependence.
18385739 2008 A variant associated with nicotine dependence, lung cancer and peripheral arterial disease.
18385738 2008 A susceptibility locus for lung cancer maps to nicotinic acetylcholine receptor subunit genes on 15q25.
18385720 2008 Genomics: when the smoke clears ...
18385676 2008 Genome-wide association scan of tag SNPs identifies a susceptibility locus for lung cancer at 15q25.1.
18227835 2008 Alpha-5/alpha-3 nicotinic receptor subunit alleles increase risk for heavy smoking.
18163978 2008 The CHRNA5/A3/B4 gene cluster variability as an important determinant of early alcohol and tobacco initiation in young adults.
17504758 2007 Transcriptional repression by a conserved intronic sequence in the nicotinic receptor alpha3 subunit gene.
17373692 2007 No evidence for association between 19 cholinergic genes and bipolar disorder.
17344216 2007 Transcription factor PHOX2A regulates the human alpha3 nicotinic receptor subunit gene promoter.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16120769 2005 RIC-3 enhances functional expression of multiple nicotinic acetylcholine receptor subtypes in mammalian cells.
16091357 2005 Ubiquilin-1 regulates nicotine-induced up-regulation of neuronal nicotinic acetylcholine receptors.
15716100 2005 In vivo RNA-RNA duplexes from human alpha3 and alpha5 nicotinic receptor subunit mRNAs.
15681842 2005 Receptor-mediated tobacco toxicity: regulation of gene expression through alpha3beta2 nicotinic receptor in oral epithelial cells.
15494367 2004 Differential regulation of keratinocyte chemokinesis and chemotaxis through distinct nicotinic receptor subtypes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12912995 2003 The effects of beta3 subunit incorporation on the pharmacology and single channel properties of oocyte-expressed human alpha3beta4 neuronal nicotinic receptors.
12663058 2003 Differential nicotinic acetylcholine receptor subunit expression in the human hippocampus.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12214130 2002 Association of novel and established polymorphisms in neuronal nicotinic acetylcholine receptors with sporadic Alzheimer's disease.
11771745 2001 Changes in nicotinic acetylcholine receptor subunits expression in brain of patients with Down syndrome and Alzheimer's disease.
11606319 2001 Formation of functional alpha3beta4alpha5 human neuronal nicotinic receptors in Xenopus oocytes: a reporter mutation approach.
11450844 2001 Characterization of the human beta4 nAChR gene and polymorphisms in CHRNA3 and CHRNB4.
11118490 2000 Stoichiometry of human recombinant neuronal nicotinic receptors containing the b3 subunit expressed in Xenopus oocytes.
10771001 2000 Transcriptional regulation of the human alpha5 nicotinic receptor subunit gene in neuronal and non-neuronal tissues.
10336173 1999 Diversity of mRNA expression for muscarinic acetylcholine receptor subtypes and neuronal nicotinic acetylcholine receptor subunits in human mononuclear leukocytes and leukemic cell lines.
10095081 1999 Regional distribution of nicotinic receptor subunit mRNAs in human brain: comparison between Alzheimer and normal brain.
9921897 1998 The structures of the human neuronal nicotinic acetylcholine receptor beta2- and alpha3-subunit genes (CHRNB2 and CHRNA3).
9804613 1998 Human and rodent bronchial epithelial cells express functional nicotinic acetylcholine receptors.
9624109 1998 A reporter mutation approach shows incorporation of the "orphan" subunit beta3 into a functional nicotinic receptor.
9387186 1997 Nicotine enhances expression of the alpha 3, alpha 4, alpha 5, and alpha 7 nicotinic receptors modulating calcium metabolism and regulating adhesion and motility of respiratory epithelial cells.
9009220 1997 Cloning and sequence of full-length cDNAs encoding the human neuronal nicotinic acetylcholine receptor (nAChR) subunits beta3 and beta4 and expression of seven nAChR subunits in the human neuroblastoma cell line SH-SY5Y and/or IMR-32.
8987816 1996 Human alpha4beta2 neuronal nicotinic acetylcholine receptor in HEK 293 cells: A patch-clamp study.
8906617 1996 Comparative structure of human neuronal alpha 2-alpha 7 and beta 2-beta 4 nicotinic acetylcholine receptor subunits and functional expression of the alpha 2, alpha 3, alpha 4, alpha 7, beta 2, and beta 4 subunits.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8878111 1996 Expression of alpha subunit genes of nicotinic acetylcholine receptors in human lymphocytes.
7850023 1994 Distribution of nicotinic receptors in the human hippocampus and thalamus.
7490471 1995 A nicotinic acetylcholine receptor regulating cell adhesion and motility is expressed in human keratinocytes.
2336208 1990 Molecular cloning of human neuronal nicotinic receptor alpha 3-subunit.
2004777 1991 Mapping of multiple subunits of the neuronal nicotinic acetylcholine receptor to chromosome 15 in man and chromosome 9 in mouse.
1989896 1991 Expression of mRNAs in human thymus coding for the alpha 3 subunit of a neuronal acetylcholine receptor.
1725184 1991 The role of the beta 4-subunit in determining the kinetic properties of rat neuronal nicotinic acetylcholine alpha 3-receptors.
1689727 1990 Alpha 3, alpha 5, and beta 4: three members of the rat neuronal nicotinic acetylcholine receptor-related gene family form a gene cluster.
1572664 1992 Chromosomal localization and physical linkage of the genes encoding the human alpha 3, alpha 5, and beta 4 neuronal nicotinic receptor subunits.