Property Summary

NCBI Gene PubMed Count 15
PubMed Score 2.97
PubTator Score 4.29

Knowledge Summary

Patent (221)

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Nicotine dependence 54 3.873 1.9
Schizoaffective Disorder 55 3.238 1.6

Expression

Gene RIF (10)

AA Sequence

MGLRSHHLSLGLLLLFLLPAECLGAEGRLALKLFRDLFANYTSALRPVADTDQTLNVTLEVTLSQIIDMD      1 - 70
ERNQVLTLYLWIRQEWTDAYLRWDPNAYGGLDAIRIPSSLVWRPDIVLYNKADAQPPGSASTNVVLRHDG     71 - 140
AVRWDAPAITRSSCRVDVAAFPFDAQHCGLTFGSWTHGGHQLDVRPRGAAASLADFVENVEWRVLGMPAR    141 - 210
RRVLTYGCCSEPYPDVTFTLLLRRRAAAYVCNLLLPCVLISLLAPLAFHLPADSGEKVSLGVTVLLALTV    211 - 280
FQLLLAESMPPAESVPLIGKYYMATMTMVTFSTALTILIMNLHYCGPSVRPVPAWARALLLGHLARGLCV    281 - 350
RERGEPCGQSRPPELSPSPQSPEGGAGPPAGPCHEPRCLCRQEALLHHVATIANTFRSHRAAQRCHEDWK    351 - 420
RLARVMDRFFLAIFFSMALVMSLLVLVQAL                                            421 - 450
//

Text Mined References (16)

PMID Year Title