Property Summary

Ligand Count 651
NCBI Gene PubMed Count 111
PubMed Score 140.77
PubTator Score 322.66

Knowledge Summary

Patent (30,541)


  Disease (5)

Disease Target Count Z-score Confidence
Brain Ischemia 110 0.0 0.0
Epilepsy 792 0.0 0.0
Memory Disorders 40 0.0 0.0
Seizures 596 0.0 0.0
Disease Target Count Z-score Confidence
Pelizaeus-Merzbacher disease 19 3.363 1.7


  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -2.100 1.3e-03
Astrocytoma, Pilocytic -1.600 1.6e-02
atypical teratoid / rhabdoid tumor -3.000 1.7e-08
diabetes mellitus 1.200 1.1e-03
ependymoma -2.300 1.0e-03
glioblastoma -1.800 4.0e-04
group 4 medulloblastoma -2.400 1.2e-02
medulloblastoma, large-cell -2.800 2.7e-03
oligodendroglioma -1.300 3.3e-02
pediatric high grade glioma -2.000 3.4e-03
primitive neuroectodermal tumor -2.800 3.7e-04
psoriasis -2.000 8.9e-67

Gene RIF (82)

AA Sequence

CNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC                                  421 - 460

Text Mined References (112)

PMID Year Title