Property Summary

NCBI Gene PubMed Count 13
PubMed Score 48.89
PubTator Score 14.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
interstitial cystitis 2237 2.4e-08
atypical teratoid / rhabdoid tumor 4971 1.5e-04
ependymoma 4559 1.2e-03
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.7

Expression

  Differential Expression (3)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 1.5e-04
ependymoma 1.100 1.2e-03
interstitial cystitis 4.900 2.4e-08

Gene RIF (4)

AA Sequence

MVPEVRVLSSLLGLALLWFPLDSHARARPDMFCLFHGKRYSPGESWHPYLEPQGLMYCLRCTCSEGAHVS      1 - 70
CYRLHCPPVHCPQPVTEPQQCCPKCVEPHTPSGLRAPPKSCQHNGTMYQHGEIFSAHELFPSRLPNQCVL     71 - 140
CSCTEGQIYCGLTTCPEPGCPAPLPLPDSCCQACKDEASEQSDEEDSVQSLHGVRHPQDPCSSDAGRKRG    141 - 210
PGTPAPTGLSAPLSFIPRHFRPKGAGSTTVKIVLKEKHKKACVHGGKTYSHGEVWHPAFRAFGPLPCILC    211 - 280
TCEDGRQDCQRVTCPTEYPCRHPEKVAGKCCKICPEDKADPGHSEISSTRCPKAPGRVLVHTSVSPSPDN    281 - 350
LRRFALEHEASDLVEIYLWKLVKGIFHLTQIKKVRKQDFQKEAQHFRLLAGPHEGHWNVFLAQTLELKVT    351 - 420
ASPDKVTKT                                                                 421 - 429
//

Text Mined References (16)

PMID Year Title