Property Summary

NCBI Gene PubMed Count 24
PubMed Score 97.91
PubTator Score 89.08

Knowledge Summary


No data available


  Disease (6)

Disease Target Count
Congenital keratoglobus 14
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.8
Disease Target Count Z-score Confidence
Cardiovascular system disease 240 0.0 1.7
Disease Target Count Z-score Confidence
Corneal degeneration 3 4.031 2.0
Scurvy 10 3.17 1.6


  Differential Expression (36)

Disease log2 FC p
acute myeloid leukemia -2.400 4.7e-02
adrenocortical carcinoma -1.498 2.2e-07
aldosterone-producing adenoma -1.192 1.9e-02
astrocytic glioma -1.600 2.3e-02
Atopic dermatitis -2.800 1.7e-04
atypical teratoid / rhabdoid tumor -2.400 8.0e-05
autosomal dominant Emery-Dreifuss muscul... 1.605 1.0e-02
Breast cancer -4.000 2.9e-02
breast carcinoma -1.200 2.2e-04
colon cancer -3.600 9.9e-04
cystic fibrosis 3.379 1.2e-07
dermatomyositis 1.200 1.6e-02
diabetes mellitus -1.100 1.8e-02
Duchenne muscular dystrophy 1.989 1.7e-08
ductal carcinoma in situ -2.800 1.0e-04
ependymoma -1.800 4.5e-02
fibroadenoma -1.600 6.6e-03
glioblastoma -1.400 1.3e-02
group 3 medulloblastoma -3.000 5.6e-03
intraductal papillary-mucinous adenoma (... -3.400 2.9e-03
intraductal papillary-mucinous carcinoma... -4.900 1.0e-04
intraductal papillary-mucinous neoplasm ... -4.600 2.7e-03
invasive ductal carcinoma -3.460 1.0e-04
juvenile dermatomyositis 1.246 3.2e-08
limb girdle muscular dystrophy 2A 1.109 2.6e-03
lung adenocarcinoma -1.900 9.1e-09
lung cancer -5.400 4.2e-07
lung carcinoma -3.600 8.4e-24
medulloblastoma, large-cell -3.200 2.4e-05
non-small cell lung cancer -3.990 6.6e-26
osteosarcoma -3.056 3.1e-02
ovarian cancer -5.700 1.3e-13
pancreatic cancer -1.100 4.0e-02
Pick disease -1.200 7.3e-03
pituitary cancer -2.300 1.5e-06
psoriasis -1.600 1.5e-04

 OMIM Phenotype (1)

 GWAS Trait (1)

Protein-protein Interaction (6)

Gene RIF (11)

AA Sequence

SQMCSSRVCRTELEDLVKVLYLERSEKGHC                                            421 - 450

Text Mined References (24)

PMID Year Title