Property Summary

NCBI Gene PubMed Count 29
PubMed Score 194.43
PubTator Score 56.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
ependymoma -1.200 1.8e-07
atypical teratoid / rhabdoid tumor -1.200 1.6e-06
medulloblastoma, large-cell -1.200 5.4e-04
intraductal papillary-mucinous neoplasm ... -1.100 3.0e-03
group 3 medulloblastoma -1.400 1.4e-02
Breast cancer 1.500 8.5e-05

Gene RIF (11)

PMID Text
26517884 Data suggest CHRD (chordin) cleavage by tolloid-like metalloproteinases is insufficient to regulate BMP(bone morphogenetic protein)/BMPR signaling; CHRD fragments and TSG (twisted gastrulation protein) contribute to inhibition of BMP/BMPR signaling.
25157165 C-terminal chordin domains play an important role in Bone morphogenetic protein regulation.
23931154 chordin silencing increased osteogenic differentiation without supplemented BMP-2.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19058174 there was no difference in the expression of the noggin and chordin between healing and nonhealing fractures
19023570 Noggin and chordin were also expressed most intensely in areas of cartilage formation and there was no difference in their expression between the non-hypertrophic and hypertrophic chondrocytes.
18533030 Bone morphogenetic protein (BMP) chordin is produced endogenously during osteogenic differentiation of human mesenchymal stem cells (MSCs); blockade of bone morphogenetic inhibitor chordin increases the rate of osteogenic differentiation of MSCs in vitro.
16449796 results suggest that CHRD could participate in regulating BMP activity in normal ovarian surface epithelium physiology, and that its mis-expression in ovarian surface epithelium may facilitate cancer incidence and/or progression
11472837 Alternatively spliced variants have different patterns of expression to influence BMP activity in varying physiolgical situations.

AA Sequence

MPSLPAPPAPLLLLGLLLLGSRPARGAGPEPPVLPIRSEKEPLPVRGAAGCTFGGKVYALDETWHPDLGE      1 - 70
PFGVMRCVLCACEAPQWGRRTRGPGRVSCKNIKPECPTPACGQPRQLPGHCCQTCPQERSSSERQPSGLS     71 - 140
FEYPRDPEHRSYSDRGEPGAEERARGDGHTDFVALLTGPRSQAVARARVSLLRSSLRFSISYRRLDRPTR    141 - 210
IRFSDSNGSVLFEHPAAPTQDGLVCGVWRAVPRLSLRLLRAEQLHVALVTLTHPSGEVWGPLIRHRALAA    211 - 280
ETFSAILTLEGPPQQGVGGITLLTLSDTEDSLHFLLLFRGLLEPRSGGLTQVPLRLQILHQGQLLRELQA    281 - 350
NVSAQEPGFAEVLPNLTVQEMDWLVLGELQMALEWAGRPGLRISGHIAARKSCDVLQSVLCGADALIPVQ    351 - 420
TGAAGSASLTLLGNGSLIYQVQVVGTSSEVVAMTLETKPQRRDQRTVLCHMAGLQPGGHTAVGICPGLGA    421 - 490
RGAHMLLQNELFLNVGTKDFPDGELRGHVAALPYCGHSARHDTLPVPLAGALVLPPVKSQAAGHAWLSLD    491 - 560
THCHLHYEVLLAGLGGSEQGTVTAHLLGPPGTPGPRRLLKGFYGSEAQGVVKDLEPELLRHLAKGMASLM    561 - 630
ITTKGSPRGELRGQVHIANQCEVGGLRLEAAGAEGVRALGAPDTASAAPPVVPGLPALAPAKPGGPGRPR    631 - 700
DPNTCFFEGQQRPHGARWAPNYDPLCSLCTCQRRTVICDPVVCPPPSCPHPVQAPDQCCPVCPEKQDVRD    701 - 770
LPGLPRSRDPGEGCYFDGDRSWRAAGTRWHPVVPPFGLIKCAVCTCKGGTGEVHCEKVQCPRLACAQPVR    771 - 840
VNPTDCCKQCPVGSGAHPQLGDPMQADGPRGCRFAGQWFPESQSWHPSVPPFGEMSCITCRCGAGVPHCE    841 - 910
RDDCSLPLSCGSGKESRCCSRCTAHRRPAPETRTDPELEKEAEGS                             911 - 955
//

Text Mined References (29)

PMID Year Title
26517884 2015 The role of chordin fragments generated by partial tolloid cleavage in regulating BMP activity.
25416956 2014 A proteome-scale map of the human interactome network.
25157165 2014 Nanoscale structure of the BMP antagonist chordin supports cooperative BMP binding.
23931154 2014 Gene silencing of chordin improves BMP-2 effects on osteogenic differentiation of human adipose tissue-derived stromal cells.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19058174 2009 Altered relative expression of BMPs and BMP inhibitors in cartilaginous areas of human fractures progressing towards nonunion.
19023570 2009 Regional and cellular localisation of BMPs and their inhibitors' expression in human fractures.
18533030 2008 Chordin knockdown enhances the osteogenic differentiation of human mesenchymal stem cells.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16449796 2006 Chordin is underexpressed in ovarian tumors and reduces tumor cell motility.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14759258 2004 An unappreciated role for RNA surveillance.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11992721 2002 Chordin-like CR domains and the regulation of evolutionarily conserved extracellular signaling systems.
11790302 2002 Opponent activities of Shh and BMP signaling during floor plate induction in vivo.
11472837 2001 The human chordin gene encodes several differentially expressed spliced variants with distinct BMP opposing activities.
11260715 2001 Homologues of Twisted gastrulation are extracellular cofactors in antagonism of BMP signalling.
10648240 2000 BMP-binding modules in chordin: a model for signalling regulation in the extracellular space.
10480362 Genomic organisation of the human chordin gene and mutation screening of candidate Cornelia de Lange syndrome genes.
10479448 1999 Mammalian BMP-1/Tolloid-related metalloproteinases, including novel family member mammalian Tolloid-like 2, have differential enzymatic activities and distributions of expression relevant to patterning and skeletogenesis.
9782094 1998 Coding sequence and expression patterns of mouse chordin and mapping of the cognate mouse chrd and human CHRD genes.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.