Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.02
PubTator Score 2.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
posterior fossa group A ependymoma 1.400 1.3e-11
glioblastoma 1.200 4.1e-05
atypical teratoid / rhabdoid tumor 1.300 2.1e-07
medulloblastoma, large-cell 1.300 1.3e-04
primitive neuroectodermal tumor 1.100 7.3e-05
pediatric high grade glioma 1.100 6.1e-06
group 3 medulloblastoma 1.500 1.7e-04
pilocytic astrocytoma 1.200 7.2e-07
ovarian cancer 1.500 1.1e-05

 GO Process (1)

Gene RIF (1)

PMID Text
24148822 -RAD21 and EIF3H, both on chromosome 8q23, CHRAC1 on chromosome 8q24.3 and TANC2 on chromosome 17q23-were confirmed to be driver genes regulating the proliferation/survival of clonogenic breast cancer cells

AA Sequence

MADVVVGKDKGGEQRLISLPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQCLATYSYRHGSGKEKK      1 - 70
VLTYSDLANTAQQSETFQFLADILPKKILASKYLKMLKEEKREEDEENDNDNESDHDEADS              71 - 131
//

Text Mined References (18)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24148822 2014 A siRNA screen identifies RAD21, EIF3H, CHRAC1 and TANC2 as driver genes within the 8q23, 8q24.3 and 17q23 amplicons in breast cancer with effects on cell growth, survival and transformation.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12434153 2002 An ACF1-ISWI chromatin-remodeling complex is required for DNA replication through heterochromatin.
11000277 2000 Cloning and characterization of the histone-fold proteins YBL1 and YCL1.
10880450 2000 HuCHRAC, a human ISWI chromatin remodelling complex contains hACF1 and two novel histone-fold proteins.