1. Home
  2. Targets
  3. calcium-binding protein
  4. phosphatase
  5. protein phosphatase
  6. Calcineurin B homologous protein 2

Tbio Calcineurin B homologous protein 2

Functions as an integral cofactor in cell pH regulation by controlling plasma membrane-type Na(+)/H(+) exchange activity. Binds to and activates SLC9A1/NHE1 in a serum-independent manner, thus increasing pH and protecting cells from serum deprivation-induced death. Also plays a role in the regulation of cell proliferation and tumor growth by increasing the phosphatase activity of PPP3CA in a calcium-dependent manner. Activator of the calcineurin/NFAT signaling pathway. Involved in the cytoplasmic translocation of the transcription factor NFATC3 to the nucleus.

This gene product is a small calcium-binding protein that regulates cell pH by controlling plasma membrane-type Na+/H+ exchange activity. This protein shares sequence similarity with calcineurin B and can bind to and stimulate the protein phosphatase activity of calcineurin A (CnA) and functions in the calcineurin/NFAT (nuclear factor of activated T cells) signaling pathway. Another member of the CHP subfamily, Calcineurin B homologous protein 1, is located on Chromosome 15 and is an inhibitor of calcineurin activity and has a genetic phenotype associated with Parkinson's Disease (OMIM:606988). This gene was initially identified as a tumor-associated antigen and was previously referred to as Hepatocellular carcinoma-associated antigen 520. [provided by RefSeq, Jul 2013]

 Comments

Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.73
PubTator Score 5.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis -2.100 2.0e-04
cutaneous lupus erythematosus -2.900 2.6e-03
osteosarcoma 1.176 5.8e-07
Atopic dermatitis -1.200 2.7e-03
colon cancer -3.900 6.5e-04
active Crohn's disease -2.490 1.1e-02
ulcerative colitis -3.800 4.5e-07
interstitial cystitis -3.300 1.3e-04
head and neck cancer and chronic obstruc... -2.000 8.0e-03

Synonym

Accession O43745 A8K2I8
Symbols

Gene

CHP2

PANTHER Protein Class (3)

PDB

2BEC  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 UniProt Keyword (16)

See all...

 GO Function (1)

 GO Component (3)

 GO Process (7)

 Compartment GO Term (14)

 IMPC Phenotype (1)

 MGI Phenotype (1)

 HCA RNA Cell Line (56)

See all...

Pathway (1)

Gene RIF (3)

PMID Text
18718049 chp2 expression in leukemia primary cells and leukemia cell lines is significantly increased.
17708351 overexpression of the CHP2 gene affects the biological behavior of ovarian cancer cell line OVCAR3 and is one of key mechanisms for ovarian carcinoma progression
16710297 These findings suggest that CHP serves as an obligatory subunit that is required both for supporting the basic activity and regulating the pH-sensing of NHE1 via interactions between distinct parts of these proteins.

AA Sequence 

MGSRSSHAAVIPDGDSIRRETGFSQASLLRLHHRFRALDRNKKGYLSRMDLQQIGALAVNPLGDRIIESF      1 - 70
FPDGSQRVDFPGFVRVLAHFRPVEDEDTETQDPKKPEPLNSRRNKLHYAFQLYDLDRDGKISRHEMLQVL     71 - 140
RLMVGVQVTEEQLENIADRTVQEADEDGDGAVSFVEFTKSLEKMDVEQKMSIRILK                  141 - 196
//

Text Mined References (15)

PMID Year Title
22189947 2012 Calcineurin homologous protein: a multifunctional Ca2+-binding protein family.
21507922 2011 Duffy-null-associated low neutrophil counts influence HIV-1 susceptibility in high-risk South African black women.
21392185 2011 Nuclear accumulation of calcineurin B homologous protein 2 (CHP2) results in enhanced proliferation of tumor cells.
18815128 2008 CHP2 activates the calcineurin/nuclear factor of activated T cells signaling pathway and enhances the oncogenic potential of HEK293 cells.
18718049 2008 [Expression of a tumor related gene chp2 in leukemia cells].
17708351 Overexpression of CHP2 enhances tumor cell growth, invasion and metastasis in ovarian cancer.
16710297 2006 Crystal structure of CHP2 complexed with NHE1-cytosolic region and an implication for pH regulation.
16541075 2006 The finished DNA sequence of human chromosome 12.
16511206 2005 Crystallization and preliminary crystallographic analysis of the human calcineurin homologous protein CHP2 bound to the cytoplasmic region of the Na+/H+ exchanger NHE1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12576672 2003 Calcineurin homologous protein isoform 2 (CHP2), Na+/H+ exchangers-binding protein, is expressed in intestinal epithelium.
12226101 2002 Expression of calcineurin B homologous protein 2 protects serum deprivation-induced cell death by serum-independent activation of Na+/H+ exchanger.
12097419 2002 Large scale identification of human hepatocellular carcinoma-associated antigens by autoantibodies.
10493829 1999 Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q.
8901634 1996 A calcineurin homologous protein inhibits GTPase-stimulated Na-H exchange.