Property Summary

NCBI Gene PubMed Count 28
PubMed Score 34.92
PubTator Score 517.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
ulcerative colitis -1.600 5.8e-05
Waldenstrons macroglobulinemia 1.019 1.1e-02
Multiple myeloma 1.570 6.3e-04
psoriasis -2.100 1.1e-04
osteosarcoma -1.365 1.3e-05
medulloblastoma -1.900 5.8e-07
atypical teratoid / rhabdoid tumor -1.400 6.6e-06
glioblastoma -1.400 4.8e-06
medulloblastoma, large-cell -2.500 1.2e-05
primitive neuroectodermal tumor -1.200 1.5e-03
pancreatic ductal adenocarcinoma liver m... -1.425 4.0e-02
lung cancer -1.200 1.4e-04
interstitial cystitis -1.100 1.3e-03
gastric carcinoma -1.500 2.2e-02
ovarian cancer -2.700 8.0e-10

 GWAS Trait (1)

Protein-protein Interaction (6)

Gene RIF (8)

PMID Text
21085126 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
18815128 CHP2 has a role in tumorigenesis and as an activator of the calcineurin/NFAT signaling pathway
18628988 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17050540 helix formation of the cytoplasmic region of NHE1 by calcineurin B homologous protein 1 is a prerequisite for generating the active form of NHE1
16511206 crystallographic analysis of the human calcineurin homologous protein CHP2 bound to the cytoplasmic region of the Na+/H+ exchanger NHE1
15035633 CHP is important for pH(i)-dependent regulation of Na+/H+ exchanger 1 (NHE1) via tightly bound Ca2+ ions which serve as a crucial structural elements required for this role.
12226101 serum-independent activation of NHE1 by bound CHP2 is one of the key mechanisms for the maintenance of high pH(i) and the resistance to serum deprivation-induced cell death in malignantly transformed cells

AA Sequence

MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAF      1 - 70
FPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEKISRDELLQVLR     71 - 140
MMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFLH                   141 - 195
//

Text Mined References (33)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21269460 2011 Initial characterization of the human central proteome.
21085126 2011 SNPs in axon guidance pathway genes and susceptibility for Parkinson's disease in the Korean population.
20720019 2010 Nuclear-localized calcineurin homologous protein CHP1 interacts with upstream binding factor and inhibits ribosomal RNA synthesis.
19165527 2009 Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18815128 2008 CHP2 activates the calcineurin/nuclear factor of activated T cells signaling pathway and enhances the oncogenic potential of HEK293 cells.
18628988 2008 Neither replication nor simulation supports a role for the axon guidance pathway in the genetics of Parkinson's disease.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17050540 2007 Solution structure of the cytoplasmic region of Na+/H+ exchanger 1 complexed with essential cofactor calcineurin B homologous protein 1.
16511206 2005 Crystallization and preliminary crystallographic analysis of the human calcineurin homologous protein CHP2 bound to the cytoplasmic region of the Na+/H+ exchanger NHE1.
16341674 2005 Transcriptome analysis of human gastric cancer.
15987692 2005 Structural characterization of calcineurin B homologous protein 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15312048 2004 Interactions among p22, glyceraldehyde-3-phosphate dehydrogenase and microtubules.
15035633 2004 Role of calcineurin B homologous protein in pH regulation by the Na+/H+ exchanger 1: tightly bound Ca2+ ions as important structural elements.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12576672 2003 Calcineurin homologous protein isoform 2 (CHP2), Na+/H+ exchangers-binding protein, is expressed in intestinal epithelium.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12226101 2002 Expression of calcineurin B homologous protein 2 protects serum deprivation-induced cell death by serum-independent activation of Na+/H+ exchanger.
12204119 2002 KIF1Bbeta2, capable of interacting with CHP, is localized to synaptic vesicles.
11481038 2001 A serine/threonine kinase which causes apoptosis-like cell death interacts with a calcineurin B-like protein capable of binding Na(+)/H(+) exchanger.
11350981 2001 Calcineurin homologous protein as an essential cofactor for Na+/H+ exchangers.
10593895 1999 Inhibition of calcineurin phosphatase activity by a calcineurin B homologous protein.
8901634 1996 A calcineurin homologous protein inhibits GTPase-stimulated Na-H exchange.
8626580 1996 A novel Ca2+-binding protein, p22, is required for constitutive membrane traffic.
7829101 1994 Isolation of novel and known genes from a human fetal cochlear cDNA library using subtractive hybridization and differential screening.