Property Summary

NCBI Gene PubMed Count 23
PubMed Score 7.10
PubTator Score 6.42

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
Atopic dermatitis -1.200 4.3e-04
interstitial cystitis -3.600 9.5e-06
spina bifida -3.169 4.7e-02
invasive ductal carcinoma 2.600 3.2e-02
ovarian cancer 3.000 6.3e-11

Protein-protein Interaction (12)

Gene RIF (14)

PMID Text
26929449 The ESCRT-III subunit CHMP4B is a key effector in abscission, whereas its paralogue, CHMP4C, is a component in the abscission checkpoint that delays abscission until chromatin is cleared from the intercellular bridge.
26712741 CHMP4C mediates radiation resistance in lung cancer cells.
25099357 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
23535730 Single nucleotide polymorphisms in CHMP4C gene is associated with ovarian cancer.
22724069 AURKB phosphorylates CHMP4C at 3 serines its C-terminal tail.Phosphorylation at these sites appears essential for CHMP4C function because their mutation leads to cytokinesis defects.
22422861 findings show CHMP4C is involved in abscission timing; this function correlated with its differential spatiotemporal distribution during late stages of cytokinesis; CHMP4C functioned in the Aurora B-dependent abscission checkpoint
21762798 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
21762796 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
21494275 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
21394083 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
18511562 The Bro1 domain of ALIX binds specifically to C-terminal residues of the human CHMP4C.
14519844 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
14505570 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
14505569 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity

AA Sequence

MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEMLGKKQEYLENRIQREIALAKKHGTQNKRAALQALK      1 - 70
RKKRFEKQLTQIDGTLSTIEFQREALENSHTNTEVLRNMGFAAKAMKSVHENMDLNKIDDLMQEITEQQD     71 - 140
IAQEISEAFSQRVGFGDDFDEDELMAELEELEQEELNKKMTNIRLPNVPSSSLPAQPNRKPGMSSTARRS    141 - 210
RAASSQRAEEEDDDIKQLAAWAT                                                   211 - 233
//

Text Mined References (25)

PMID Year Title
26929449 2016 ALIX and ESCRT-I/II function as parallel ESCRT-III recruiters in cytokinetic abscission.
26712741 2015 CHMP4C Disruption Sensitizes the Human Lung Cancer Cells to Irradiation.
24814515 2014 ANCHR mediates Aurora-B-dependent abscission checkpoint control through retention of VPS4.
23535730 2013 GWAS meta-analysis and replication identifies three new susceptibility loci for ovarian cancer.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22724069 2012 The chromosomal passenger complex controls the function of endosomal sorting complex required for transport-III Snf7 proteins during cytokinesis.
22660413 2012 Syndecan-syntenin-ALIX regulates the biogenesis of exosomes.
22547407 2012 ALIX binds a YPX(3)L motif of the GPCR PAR1 and mediates ubiquitin-independent ESCRT-III/MVB sorting.
22422861 2012 ESCRT-III governs the Aurora B-mediated abscission checkpoint through CHMP4C.
20616062 2010 Human ESCRT-III and VPS4 proteins are required for centrosome and spindle maintenance.
20588296 2010 Membrane budding and scission by the ESCRT machinery: it's all in the neck.
19302785 2009 Ab initio protein modelling reveals novel human MIT domains.
18511562 2008 ALIX-CHMP4 interactions in the human ESCRT pathway.
17711858 2007 The MIT domain of UBPY constitutes a CHMP binding and endosomal localization signal required for efficient epidermal growth factor receptor degradation.
16730941 2006 A systematic analysis of human CHMP protein interactions: additional MIT domain-containing proteins bind to multiple components of the human ESCRT III complex.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14678797 2004 CHMP4b is a major binding partner of the ALG-2-interacting protein Alix among the three CHMP4 isoforms.
14583093 2004 Structure and function of human Vps20 and Snf7 proteins.
14519844 2003 Divergent retroviral late-budding domains recruit vacuolar protein sorting factors by using alternative adaptor proteins.
14505570 2003 The protein network of HIV budding.
14505569 2003 AIP1/ALIX is a binding partner for HIV-1 p6 and EIAV p9 functioning in virus budding.
12860994 2003 The ALG-2-interacting protein Alix associates with CHMP4b, a human homologue of yeast Snf7 that is involved in multivesicular body sorting.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11031247 2000 Secretory protein trafficking and organelle dynamics in living cells.