Property Summary

NCBI Gene PubMed Count 50
PubMed Score 3.97
PubTator Score 23.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.400 3.3e-03
medulloblastoma -1.200 3.9e-03
medulloblastoma, large-cell -2.100 7.1e-05
primary pancreatic ductal adenocarcinoma 1.266 6.8e-03
Breast cancer 2.400 2.5e-02
adult high grade glioma -1.600 3.1e-03
Pick disease -1.100 1.2e-05
ulcerative colitis -1.200 7.1e-09
ovarian cancer -1.300 7.0e-05
pancreatic cancer 1.100 1.5e-02

 MGI Phenotype (1)

 GWAS Trait (1)

Gene RIF (25)

PMID Text
26929449 The ESCRT-III subunit CHMP4B is a key effector in abscission, whereas its paralogue, CHMP4C, is a component in the abscission checkpoint that delays abscission until chromatin is cleared from the intercellular bridge.
26866605 homologous domain of human Bro1 domain-containing proteins, Alix and Brox, binds CHMP4B but not STAM2, despite their high structural similarity
25874485 our results implied that CHMP4B could be a promising prognostic biomarker as well as a potential therapeutic target of HCC.
25710462 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
25099357 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
25010285 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
24741567 CHMP4B, through its association with chromatin, may participate in the autophagolysosomal degradation of micronuclei and other extranuclear chromatin.
24436186 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
24107264 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
23027949 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
22406677 CHMP4B interacts directly with CC2D1A and CC2D1B with nanomolar affinity by forming a 1:1 complex.
22258254 CC2D1A interaction with CHMP4B/4A blocks HIV-1 budding.
21975012 hSnf7-1 and hSnf7-2 are preferentially associated with CHMP2A and CHMP2B, respectively, and regulate the turnover of distinct transmembrane cargos such as neurotransmitter receptors in human neurons.
21494275 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
21394083 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
19016654 The CHMP4b- and Src-docking sites in the Bro1 domain are autoinhibited in the native state of Alix.
18511562 The Bro1 domain of ALIX binds specifically to C-terminal residues of the human CHMP4B.
18209100 Study demonstrates that CHMP4A and CHMP4B proteins form novel membrane-attached filaments that can promote or stabilize negative curvature and outward budding.
18190528 Results suggest that efficient interaction between CHMP4s and Brox requires Brox farnesylation.
17701905 These data provide the first evidence that CHMP4B plays a vital role the maintenance of lens transparency.
17428861 ALIX can have a dramatic effect on HIV-1 release by binding at the CHMP4B site; the ability to use ALIX may allow HIV-1 to replicate in cells that express only low levels of Tsg101
14519844 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
14505570 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
14505569 Superresolution imaging of HIV-1 Gag and ESCRT proteins (TSG101, ALIX, CHMP4B, and CHMP4C) demonstrates in HeLa cells that Gag assemblages often has ESCRT proteins in their direct vicinity
12860994 CHMP4b and Alix participate in formation of multivesicular bodies by cooperating with SKD1

AA Sequence

MSVFGKLFGAGGGKAGKGGPTPQEAIQRLRDTEEMLSKKQEFLEKKIEQELTAAKKHGTKNKRAALQALK      1 - 70
RKKRYEKQLAQIDGTLSTIEFQREALENANTNTEVLKNMGYAAKAMKAAHDNMDIDKVDELMQDIADQQE     71 - 140
LAEEISTAISKPVGFGEEFDEDELMAELEELEQEELDKNLLEISGPETVPLPNVPSIALPSKPAKKKEEE    141 - 210
DDDMKELENWAGSM                                                            211 - 224
//

Text Mined References (59)

PMID Year Title
26929449 2016 ALIX and ESCRT-I/II function as parallel ESCRT-III recruiters in cytokinetic abscission.
26866605 2016 Structural Study of the HD-PTP Bro1 Domain in a Complex with the Core Region of STAM2, a Subunit of ESCRT-0.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26040712 2015 Spastin and ESCRT-III coordinate mitotic spindle disassembly and nuclear envelope sealing.
25874485 2015 High CHMP4B expression is associated with accelerated cell proliferation and resistance to doxorubicin in hepatocellular carcinoma.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24878737 2014 Structure of cellular ESCRT-III spirals and their relationship to HIV budding.
24741567 2014 Association of CHMP4B and autophagy with micronuclei: implications for cataract formation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24107264 2013 ESCRT requirements for EIAV budding.
24095276 2013 Syntaxin 13, a genetic modifier of mutant CHMP2B in frontotemporal dementia, is required for autophagosome maturation.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23362303 2013 Genome-wide association study identifies novel loci associated with concentrations of four plasma phospholipid fatty acids in the de novo lipogenesis pathway: results from the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) consortium.
23051622 2013 ESCRT-III CHMP2A and CHMP3 form variable helical polymers in vitro and act synergistically during HIV-1 budding.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22724069 2012 The chromosomal passenger complex controls the function of endosomal sorting complex required for transport-III Snf7 proteins during cytokinesis.
22660413 2012 Syndecan-syntenin-ALIX regulates the biogenesis of exosomes.
22547407 2012 ALIX binds a YPX(3)L motif of the GPCR PAR1 and mediates ubiquitin-independent ESCRT-III/MVB sorting.
22406677 2012 CC2D1A is a regulator of ESCRT-III CHMP4B.
22258254 2012 Regulation of CHMP4/ESCRT-III function in human immunodeficiency virus type 1 budding by CC2D1A.
21975012 2011 ESCRT-III subunits Snf7-1 and Snf7-2 differentially regulate transmembrane cargos in hESC-derived human neurons.
21543490 2011 Mechanism of inhibition of retrovirus release from cells by interferon-induced gene ISG15.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21310966 2011 Cortical constriction during abscission involves helices of ESCRT-III-dependent filaments.
21269460 2011 Initial characterization of the human central proteome.
21118109 2010 The role of ESCRT proteins in fusion events involving lysosomes, endosomes and autophagosomes.
20616062 2010 Human ESCRT-III and VPS4 proteins are required for centrosome and spindle maintenance.
20588296 2010 Membrane budding and scission by the ESCRT machinery: it's all in the neck.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20208530 2010 PtdIns(3)P controls cytokinesis through KIF13A-mediated recruitment of FYVE-CENT to the midbody.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19016654 2009 The CHMP4b- and Src-docking sites in the Bro1 domain are autoinhibited in the native state of Alix.
18511562 2008 ALIX-CHMP4 interactions in the human ESCRT pathway.
18434552 2008 The Bro1-related protein HD-PTP/PTPN23 is required for endosomal cargo sorting and multivesicular body morphogenesis.
18209100 2008 Plasma membrane deformation by circular arrays of ESCRT-III protein filaments.
18190528 2008 Brox, a novel farnesylated Bro1 domain-containing protein that associates with charged multivesicular body protein 4 (CHMP4).
17711858 2007 The MIT domain of UBPY constitutes a CHMP binding and endosomal localization signal required for efficient epidermal growth factor receptor degradation.
17701905 2007 CHMP4B, a novel gene for autosomal dominant cataracts linked to chromosome 20q.
17428861 2007 Potent rescue of human immunodeficiency virus type 1 late domain mutants by ALIX/AIP1 depends on its CHMP4 binding site.
17174262 2007 HD-PTP and Alix share some membrane-traffic related proteins that interact with their Bro1 domains or proline-rich regions.
17146056 2006 Release of autoinhibition converts ESCRT-III components into potent inhibitors of HIV-1 budding.
16856878 2006 CHMP7, a novel ESCRT-III-related protein, associates with CHMP4b and functions in the endosomal sorting pathway.
16730941 2006 A systematic analysis of human CHMP protein interactions: additional MIT domain-containing proteins bind to multiple components of the human ESCRT III complex.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15511219 2005 Human CHMP6, a myristoylated ESCRT-III protein, interacts directly with an ESCRT-II component EAP20 and regulates endosomal cargo sorting.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15007060 2004 Misfolding diverts CFTR from recycling to degradation: quality control at early endosomes.
14678797 2004 CHMP4b is a major binding partner of the ALG-2-interacting protein Alix among the three CHMP4 isoforms.
14583093 2004 Structure and function of human Vps20 and Snf7 proteins.
14519844 2003 Divergent retroviral late-budding domains recruit vacuolar protein sorting factors by using alternative adaptor proteins.
14505570 2003 The protein network of HIV budding.
14505569 2003 AIP1/ALIX is a binding partner for HIV-1 p6 and EIAV p9 functioning in virus budding.
12860994 2003 The ALG-2-interacting protein Alix associates with CHMP4b, a human homologue of yeast Snf7 that is involved in multivesicular body sorting.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11031247 2000 Secretory protein trafficking and organelle dynamics in living cells.