Property Summary

NCBI Gene PubMed Count 29
PubMed Score 14.79
PubTator Score 21.52

Knowledge Summary

Patent

No data available

Expression

Gene RIF (18)

PMID Text
24107264 ALIX, CHMP2A/B, CHMP4A/B, and VPS4A/B proteins are required for the budding of HIV-1 Gag and the HIV-1 infectivity
23527201 Chmp4, through Alix, recruits the human parainfluenza virus type 1 - C proteins to a common site on intracellular membranes and facilitates budding.
22762019 ALIX, CHMP2A/B, CHMP4A/B, and VPS4A/B proteins are required for the budding of HIV-1 Gag and the HIV-1 infectivity
22754649 ALIX, CHMP2A/B, CHMP4A/B, and VPS4A/B proteins are required for the budding of HIV-1 Gag and the HIV-1 infectivity
22258254 CC2D1A interaction with CHMP4B/4A blocks HIV-1 budding.
21975012 hSnf7-1 and hSnf7-2 are preferentially associated with CHMP2A and CHMP2B, respectively, and regulate the turnover of distinct transmembrane cargos such as neurotransmitter receptors in human neurons.
21789505 ALIX, CHMP2A/B, CHMP4A/B, and VPS4A/B proteins are required for the budding of HIV-1 Gag and the HIV-1 infectivity
21762798 ALIX, CHMP2A/B, CHMP4A/B, and VPS4A/B proteins are required for the budding of HIV-1 Gag and the HIV-1 infectivity
21762796 ALIX, CHMP2A/B, CHMP4A/B, and VPS4A/B proteins are required for the budding of HIV-1 Gag and the HIV-1 infectivity
20888838 our results show that CHMP4A significantly enhances the stability and transcriptional activity of HIF-1alpha both under normoxic and hypoxic conditions
19143627 ALIX, CHMP2A/B, CHMP4A/B, and VPS4A/B proteins are required for the budding of HIV-1 Gag and the HIV-1 infectivity
18511562 The Bro1 domain of ALIX binds specifically to C-terminal residues of the human CHMP4A.
18209100 Study demonstrates that CHMP4A and CHMP4B proteins form novel membrane-attached filaments that can promote or stabilize negative curvature and outward budding.
17547705 Cycles between a default 'closed' state and an activated 'open' state under control of sequences at their C-terminus and associated factors.
15632132 hSnf7-1 binds to itself, membranes, and the AAA+ ATPase SKD1
14519844 ALIX, CHMP2A/B, CHMP4A/B, and VPS4A/B proteins are required for the budding of HIV-1 Gag and the HIV-1 infectivity
14505570 ALIX, CHMP2A/B, CHMP4A/B, and VPS4A/B proteins are required for the budding of HIV-1 Gag and the HIV-1 infectivity
14505569 ALIX, CHMP2A/B, CHMP4A/B, and VPS4A/B proteins are required for the budding of HIV-1 Gag and the HIV-1 infectivity

AA Sequence

MSGLGRLFGKGKKEKGPTPEEAIQKLKETEKILIKKQEFLEQKIQQELQTAKKYGTKNKRAALQALRRKK      1 - 70
RFEQQLAQTDGTLSTLEFQREAIENATTNAEVLRTMELAAQSMKKAYQDMDIDKVDELMTDITEQQEVAQ     71 - 140
QISDAISRPMGFGDDVDEDELLEELEELEQEELAQELLNVGDKEEEPSVKLPSVPSTHLPAGPAPKVDED    141 - 210
EEALKQLAEWVS                                                              211 - 222
//

Text Mined References (33)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24878737 2014 Structure of cellular ESCRT-III spirals and their relationship to HIV budding.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24107264 2013 ESCRT requirements for EIAV budding.
23527201 2013 Alix serves as an adaptor that allows human parainfluenza virus type 1 to interact with the host cell ESCRT system.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22724069 2012 The chromosomal passenger complex controls the function of endosomal sorting complex required for transport-III Snf7 proteins during cytokinesis.
22660413 2012 Syndecan-syntenin-ALIX regulates the biogenesis of exosomes.
22258254 2012 Regulation of CHMP4/ESCRT-III function in human immunodeficiency virus type 1 budding by CC2D1A.
21975012 2011 ESCRT-III subunits Snf7-1 and Snf7-2 differentially regulate transmembrane cargos in hESC-derived human neurons.
20888838 2010 High-throughput screening identifies CHMP4A associated with hypoxia-inducible factor 1.
20616062 2010 Human ESCRT-III and VPS4 proteins are required for centrosome and spindle maintenance.
20588296 2010 Membrane budding and scission by the ESCRT machinery: it's all in the neck.
18511562 2008 ALIX-CHMP4 interactions in the human ESCRT pathway.
18209100 2008 Plasma membrane deformation by circular arrays of ESCRT-III protein filaments.
17853893 2007 Human ESCRT and ALIX proteins interact with proteins of the midbody and function in cytokinesis.
17547705 2007 Structure/function analysis of four core ESCRT-III proteins reveals common regulatory role for extreme C-terminal domain.
17350572 2007 Structural and biochemical studies of ALIX/AIP1 and its role in retrovirus budding.
16730941 2006 A systematic analysis of human CHMP protein interactions: additional MIT domain-containing proteins bind to multiple components of the human ESCRT III complex.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15632132 2005 Interaction of the mammalian endosomal sorting complex required for transport (ESCRT) III protein hSnf7-1 with itself, membranes, and the AAA+ ATPase SKD1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14678797 2004 CHMP4b is a major binding partner of the ALG-2-interacting protein Alix among the three CHMP4 isoforms.
14583093 2004 Structure and function of human Vps20 and Snf7 proteins.
14519844 2003 Divergent retroviral late-budding domains recruit vacuolar protein sorting factors by using alternative adaptor proteins.
14505570 2003 The protein network of HIV budding.
14505569 2003 AIP1/ALIX is a binding partner for HIV-1 p6 and EIAV p9 functioning in virus budding.
12860994 2003 The ALG-2-interacting protein Alix associates with CHMP4b, a human homologue of yeast Snf7 that is involved in multivesicular body sorting.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
11031247 2000 Secretory protein trafficking and organelle dynamics in living cells.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.