Property Summary

NCBI Gene PubMed Count 30
PubMed Score 16.25
PubTator Score 21.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Fragile X syndrome 34 3.523 1.8

Expression

Gene RIF (18)

AA Sequence

MSGLGRLFGKGKKEKGPTPEEAIQKLKETEKILIKKQEFLEQKIQQELQTAKKYGTKNKRAALQALRRKK      1 - 70
RFEQQLAQTDGTLSTLEFQREAIENATTNAEVLRTMELAAQSMKKAYQDMDIDKVDELMTDITEQQEVAQ     71 - 140
QISDAISRPMGFGDDVDEDELLEELEELEQEELAQELLNVGDKEEEPSVKLPSVPSTHLPAGPAPKVDED    141 - 210
EEALKQLAEWVS                                                              211 - 222
//

Text Mined References (34)

PMID Year Title