Property Summary

NCBI Gene PubMed Count 46
PubMed Score 32.75
PubTator Score 24.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.007 6.1e-03
osteosarcoma 2.180 1.9e-07
atypical teratoid / rhabdoid tumor -1.300 1.7e-06
medulloblastoma, large-cell -1.200 8.4e-05
lung cancer -1.200 2.5e-03
Breast cancer 2.700 4.3e-02
lung adenocarcinoma -1.600 8.5e-16
ovarian cancer -2.000 6.6e-09

Protein-protein Interaction (8)

Gene RIF (16)

PMID Text
24440309 Protein kinase CK2 alpha is involved in the phosphorylation of the ESCRT-III subunits CHMP3 and CHMP2B, as well as of VPS4B/SKD1, an ATPase that mediates ESCRT-III disassembly.
23051622 Recruitment of CHMP2A and CHMP3 by CHMP4B to HIV-1 Gag puncta is observed in in-vitro membrane model
23027949 Recruitment of CHMP2A and CHMP3 by CHMP4B to HIV-1 Gag puncta is observed in in-vitro membrane model
21827950 tight coupling of ESCRT-III CHMP3 and AMSH functions and provide insight into the regulation of ESCRT-III
20427536 Recruitment of CHMP2A and CHMP3 by CHMP4B to HIV-1 Gag puncta is observed in in-vitro membrane model
19525971 Data show that the N-terminal core domains of increased sodium tolerance-1 (IST1) and charged multivesicular body protein-3 (CHMP3) form equivalent four-helix bundles, revealing that IST1 is a previously unrecognized ESCRT-III family member.
18687924 study found the ESCRT-III proteins CHMP2A & CHMP3 could assemble in vitro into helical tubular structures that expose their membrane interaction sites on the outside of the tubule; VPS4 could bind on the inside of the tubule & disassemble the tubes
17711858 UBPY MIT domain and another ubiquitin isopeptidase, AMSH, reveals common interactions with CHMP1A and CHMP1B but a distinct selectivity of AMSH for CHMP3/VPS24, a core subunit of the ESCRT-III complex, and UBPY for CHMP7.
17686835 expression of dominant negative forms of Vps4 and Vps24, two components of the MVB pathway, rresult in an impairment in infectious herpes simplex virus assembly/egress
17331679 Data demonstrate that the VPS24 gene gives rise to two functionally distinct proteins, one of which is involved in the ESCRT pathway and another novel protein that serves an anti-apoptotic role.
17261583 A dominant-negative version of CHMP3, which specifically prevents targeting of AMSH (STAMBP) to endosomes, inhibits degradation but not internalization of epidermal growth factor receptor.
17146056 CHMP proteins are regulated through an autoinhibitory switch mechanism that allows tight control of endosomal sorting complex ESCRT-III assembly
16554368 ESCRT subunit is important for degradation of the epidermal growth factor receptor (EGFR) and for transport of the receptor from endosomes to lysosomes.
16302002 data suggest that mac25/IGFBP-rP1 and 25.1 (NEDF) may play a functional role in the NE differentiation of NSCLC cell lines and may provide a novel therapeutic target for treating lung cancers, in particular NSCLC with NE differentiation
12878588 In rodents, this protein selectively binds phosphatidylinositol 3,5-bisphosphate and phosphatidylinositol 3,4-bisphosphate and may participate in endosomal trafficking.
12775420 Recruitment of CHMP2A and CHMP3 by CHMP4B to HIV-1 Gag puncta is observed in in-vitro membrane model

AA Sequence

MGLFGKTQEKPPKELVNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKDVCIVLAKEMIRS      1 - 70
RKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKIPEIQATMRELSKEMMKAGII     71 - 140
EEMLEDTFESMDDQEEMEEEAEMEIDRILFEITAGALGKAPSKVTDALPEPEPPGAMAASEDEEEEEEAL    141 - 210
EAMQSRLATLRS                                                              211 - 222
//

Text Mined References (55)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
24878737 2014 Structure of cellular ESCRT-III spirals and their relationship to HIV budding.
24440309 2014 CK2 involvement in ESCRT-III complex phosphorylation.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23105106 2012 Interactions of the human LIP5 regulatory protein with endosomal sorting complexes required for transport.
23051622 2013 ESCRT-III CHMP2A and CHMP3 form variable helical polymers in vitro and act synergistically during HIV-1 budding.
22660413 2012 Syndecan-syntenin-ALIX regulates the biogenesis of exosomes.
21827950 2011 Structural basis for ESCRT-III CHMP3 recruitment of AMSH.
21543490 2011 Mechanism of inhibition of retrovirus release from cells by interferon-induced gene ISG15.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21118109 2010 The role of ESCRT proteins in fusion events involving lysosomes, endosomes and autophagosomes.
20805225 2010 Activation of human VPS4A by ESCRT-III proteins reveals ability of substrates to relieve enzyme autoinhibition.
20616062 2010 Human ESCRT-III and VPS4 proteins are required for centrosome and spindle maintenance.
20588296 2010 Membrane budding and scission by the ESCRT machinery: it's all in the neck.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19615732 2009 Defining the human deubiquitinating enzyme interaction landscape.
19525971 2009 Structural basis for ESCRT-III protein autoinhibition.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18687924 2008 Helical structures of ESCRT-III are disassembled by VPS4.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18395747 2008 Structural basis for autoinhibition of ESCRT-III CHMP3.
18385515 2008 Novel interactions of ESCRT-III with LIP5 and VPS4 and their implications for ESCRT-III disassembly.
18076377 2008 A dominant-negative ESCRT-III protein perturbs cytokinesis and trafficking to lysosomes.
17711858 2007 The MIT domain of UBPY constitutes a CHMP binding and endosomal localization signal required for efficient epidermal growth factor receptor degradation.
17686835 2007 Intracellular trafficking and maturation of herpes simplex virus type 1 gB and virus egress require functional biogenesis of multivesicular bodies.
17547705 2007 Structure/function analysis of four core ESCRT-III proteins reveals common regulatory role for extreme C-terminal domain.
17331679 2007 Characterization of a novel alternatively spliced human transcript encoding an N-terminally truncated Vps24 protein that suppresses the effects of Bax in an ESCRT independent manner in yeast.
17261583 2007 Targeting of AMSH to endosomes is required for epidermal growth factor receptor degradation.
17146056 2006 Release of autoinhibition converts ESCRT-III components into potent inhibitors of HIV-1 budding.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16740483 2006 Structural basis for budding by the ESCRT-III factor CHMP3.
16730941 2006 A systematic analysis of human CHMP protein interactions: additional MIT domain-containing proteins bind to multiple components of the human ESCRT III complex.
16554368 2006 The ESCRT-III subunit hVps24 is required for degradation but not silencing of the epidermal growth factor receptor.
16533400 2006 NovelFam3000--uncharacterized human protein domains conserved across model organisms.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16302002 2006 Neuroendocrine-like differentiation of non-small cell lung carcinoma cells: regulation by cAMP and the interaction of mac25/IGFBP-rP1 and 25.1.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15707591 2005 mVps24p functions in EGF receptor sorting/trafficking from the early endosome.
15632132 2005 Interaction of the mammalian endosomal sorting complex required for transport (ESCRT) III protein hSnf7-1 with itself, membranes, and the AAA+ ATPase SKD1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14519844 2003 Divergent retroviral late-budding domains recruit vacuolar protein sorting factors by using alternative adaptor proteins.
14505570 2003 The protein network of HIV budding.
14505569 2003 AIP1/ALIX is a binding partner for HIV-1 p6 and EIAV p9 functioning in virus budding.
12878588 2003 Identification of mammalian Vps24p as an effector of phosphatidylinositol 3,5-bisphosphate-dependent endosome compartmentalization.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12194857 2002 Escrt-III: an endosome-associated heterooligomeric protein complex required for mvb sorting.
11549700 2001 Interaction of IGF-binding protein-related protein 1 with a novel protein, neuroendocrine differentiation factor, results in neuroendocrine differentiation of prostate cancer cells.
11031247 2000 Secretory protein trafficking and organelle dynamics in living cells.
10810093 2000 Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.