Property Summary

NCBI Gene PubMed Count 40
PubMed Score 1847.20
PubTator Score 80.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (23)

Disease log2 FC p
nephrosclerosis -1.119 2.4e-03
malignant mesothelioma -6.200 8.5e-09
astrocytic glioma -2.200 9.6e-03
posterior fossa group A ependymoma -2.600 2.5e-06
psoriasis -2.500 1.2e-07
oligodendroglioma -1.200 1.0e-04
osteosarcoma -3.922 2.7e-03
sonic hedgehog group medulloblastoma -3.400 1.8e-04
atypical teratoid / rhabdoid tumor -4.700 5.8e-06
glioblastoma -1.800 1.4e-02
medulloblastoma, large-cell -3.700 8.8e-08
Atopic dermatitis -1.100 6.1e-03
lung cancer 5.400 1.7e-07
colon cancer -2.300 9.7e-05
interstitial cystitis 1.200 4.6e-02
pilocytic astrocytoma 1.200 8.0e-03
nasopharyngeal carcinoma -2.200 9.5e-05
breast carcinoma -2.100 1.9e-26
Pick disease -1.700 1.4e-02
Breast cancer -4.200 7.7e-34
ductal carcinoma in situ -2.200 1.0e-03
invasive ductal carcinoma -3.000 3.3e-04
pituitary cancer -1.500 9.9e-03

Gene RIF (24)

PMID Text
25943212 CHL1 expression patient-derived lymphoblasts correlated with clinical outcome in depressive disorder patients.
24971532 Our data collectively indicate that miR-182 in PTC promotes cell proliferation and invasion through direct suppression of CHL1, supporting the potential utility of miR-182 inhibition as a novel therapeutic strategy against PTC.
24512353 There was no statistical association between polymorphisms of the CHL1 gene and idiopathic scoliosis in a Chinese population.
24288179 our findings suggest that miR-590-5p acts as an oncogene by targeting the CHL1 gene and promotes cervical cancer proliferation
24203666 In 1 of 113 Colombian children with refractory epilepsy, MLPA showed a subtelomeric duplication of exon 3 of CHL1, also present in 2 relatives.
23906755 CHL1 has a role in human breast tumorigenesis and progression
23857787 The rs2272522 polymorphism (in the CHL1 gene) was found to exhibit a highly significant association with schizophrenia in the Qatari population.
22988240 BACE1(-/-) axon guidance defects are likely the result of abrogated BACE1 processing of CHL1 and BACE1 deficiency produces a CHL1 loss-of-function phenotype
22909203 The miRNA miR-151-3p had 6.7-fold higher basal expression in paroxetine-sensitive LCLs. This corresponds with lower expression of CHL1, a target of miR-151-3p
22744455 Overall, our study found a significant association of IL-17RC gene polymorphisms with AIS in a Chinese Han population, indicating IL-17RC gene may be as a susceptibility gene for AIS.
22634495 miR-10a expression is upregulated in cervical cancer tissues, and miR-10a promotes cell growth, migration and invasion by targeting CHL1 in human cervical cancer cells.
21408220 CHL1 is involved in the development of different human cancers.
21332311 Genome-wide transcriptional profiling of in vitro phenotyped LCLs identified CHL1 and additional genes implicated in synaptogenesis and brain circuitry as putative SSRI response biomarkers.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20298200 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19509545 results do not support the candidacy of CHL1, CNTN6, and CNTN4 as tumor suppressor genes in the 3p26-pter region in ovarian cancer
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
17592550 CHL1 expression was uniformly positive on a cell line derived from angiomyolipoma.
16597699 MAP kinase pathway regulates L1-CAM-mediated nerve growth by modulating ankyrin binding.
15704102 L1 could drive progression by enhancing cell migration and tumor growth in ovarian carcinoma.
15653271 Observational study of gene-disease association. (HuGE Navigator)
11986985 Observational study of gene-disease association. (HuGE Navigator)
11986985 An association between a missense polymorphism in the close homologue of L1 (CHL1, CALL) gene and schizophrenia.

AA Sequence

MEPLLLGRGLIVYLMFLLLKFSKAIEIPSSVQQVPTIIKQSKVQVAFPFDEYFQIECEAKGNPEPTFSWT      1 - 70
KDGNPFYFTDHRIIPSNNSGTFRIPNEGHISHFQGKYRCFASNKLGIAMSEEIEFIVPSVPKFPKEKIDP     71 - 140
LEVEEGDPIVLPCNPPKGLPPLHIYWMNIELEHIEQDERVYMSQKGDLYFANVEEKDSRNDYCCFAAFPR    141 - 210
LRTIVQKMPMKLTVNSSNSIKQRKPKLLLPPTESGSESSITILKGEILLLECFAEGLPTPQVDWNKIGGD    211 - 280
LPKGRETKENYGKTLKIENVSYQDKGNYRCTASNFLGTATHDFHVIVEEPPRWTKKPQSAVYSTGSNGIL    281 - 350
LCEAEGEPQPTIKWRVNGSPVDNHPFAGDVVFPREISFTNLQPNHTAVYQCEASNVHGTILANANIDVVD    351 - 420
VRPLIQTKDGENYATVVGYSAFLHCEFFASPEAVVSWQKVEEVKPLEGRRYHIYENGTLQINRTTEEDAG    421 - 490
SYSCWVENAIGKTAVTANLDIRNATKLRVSPKNPRIPKLHMLELHCESKCDSHLKHSLKLSWSKDGEAFE    491 - 560
INGTEDGRIIIDGANLTISNVTLEDQGIYCCSAHTALDSAADITQVTVLDVPDPPENLHLSERQNRSVRL    561 - 630
TWEAGADHNSNISEYIVEFEGNKEEPGRWEELTRVQGKKTTVILPLAPFVRYQFRVIAVNEVGRSQPSQP    631 - 700
SDHHETPPAAPDRNPQNIRVQASQPKEMIIKWEPLKSMEQNGPGLEYRVTWKPQGAPVEWEEETVTNHTL    701 - 770
RVMTPAVYAPYDVKVQAINQLGSGPDPQSVTLYSGEDYPDTAPVIHGVDVINSTLVKVTWSTVPKDRVHG    771 - 840
RLKGYQINWWKTKSLLDGRTHPKEVNILRFSGQRNSGMVPSLDAFSEFHLTVLAYNSKGAGPESEPYIFQ    841 - 910
TPEGVPEQPTFLKVIKVDKDTATLSWGLPKKLNGNLTGYLLQYQIINDTYEIGELNDINITTPSKPSWHL    911 - 980
SNLNATTKYKFYLRACTSQGCGKPITEESSTLGEGSKGIGKISGVNLTQKTHPIEVFEPGAEHIVRLMTK    981 - 1050
NWGDNDSIFQDVIETRGREYAGLYDDISTQGWFIGLMCAIALLTLLLLTVCFVKRNRGGKYSVKEKEDLH   1051 - 1120
PDPEIQSVKDETFGEYSDSDEKPLKGSLRSLNRDMQPTESADSLVEYGEGDHGLFSEDGSFIGAYAGSKE   1121 - 1190
KGSVESNGSSTATFPLRA                                                       1191 - 1208
//

Text Mined References (42)

PMID Year Title
25943212 2015 CHL1, ITGB3 and SLC6A4 gene expression and antidepressant drug response: results from the Munich Antidepressant Response Signature (MARS) study.
24971532 2014 miR-182 targets CHL1 and controls tumor growth and invasion in papillary thyroid carcinoma.
24512353 2014 Lack of association between the CHL1 gene and adolescent idiopathic scoliosis susceptibility in Han Chinese: a case-control study.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24288179 2014 MicroRNA-590 promotes cervical cancer cell growth and invasion by targeting CHL1.
24203666 2013 [Detection of subtelomeric rearrangements due to MLPA in paediatric patients with refractory epilepsy in Colombia: the role of the CHL1 gene in pharmacoresistance].
23906755 2013 CHL1 is involved in human breast tumorigenesis and progression.
23857787 2013 Significant association of close homologue of L1 gene polymorphism rs2272522 with schizophrenia in Qatar.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22988240 2012 ?-Site amyloid precursor protein (APP)-cleaving enzyme 1 (BACE1)-deficient mice exhibit a close homolog of L1 (CHL1) loss-of-function phenotype involving axon guidance defects.
22909203 2012 Genome-wide miRNA expression profiling of human lymphoblastoid cell lines identifies tentative SSRI antidepressant response biomarkers.
22744455 2012 Association study of IL-17RC, CHL1, DSCAM and CNTNAP2 genes polymorphisms with adolescent idiopathic scoliosis susceptibility in a Chinese Han population.
22634495 2012 MicroRNA-10a targets CHL1 and promotes cell growth, migration and invasion in human cervical cancer cells.
22581228 2012 A genome-wide approach accounting for body mass index identifies genetic variants influencing fasting glycemic traits and insulin resistance.
22219177 2012 A genome-wide search for loci interacting with known prostate cancer risk-associated genetic variants.
22041458 2012 Pharmacogenomic study of side-effects for antidepressant treatment options in STAR*D.
21860410 2012 HIF-1-dependent expression of angiopoietin-like 4 and L1CAM mediates vascular metastasis of hypoxic breast cancer cells to the lungs.
21658281 2011 GWAS for discovery and replication of genetic loci associated with sudden cardiac arrest in patients with coronary artery disease.
21408220 2011 Differential expression of CHL1 gene during development of major human cancers.
21332311 2011 Genome-wide expression profiling of human lymphoblastoid cell lines identifies CHL1 as a putative SSRI antidepressant response biomarker.
21216876 2011 Genome-wide association studies of adolescent idiopathic scoliosis suggest candidate susceptibility genes.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20339536 2010 Genome-wide association of lipid-lowering response to statins in combined study populations.
20298200 2010 Confirmed rare copy number variants implicate novel genes in schizophrenia.
19509545 2009 Molecular genetic analysis of a cell adhesion molecule with homology to L1CAM, contactin 6, and contactin 4 candidate chromosome 3p26pter tumor suppressor genes in ovarian cancer.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
17592550 Expression of the neural stem cell markers NG2 and L1 in human angiomyolipoma: are angiomyolipomas neoplasms of stem cells?
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16597699 2006 MAP kinase pathway-dependent phosphorylation of the L1-CAM ankyrin binding site regulates neuronal growth.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15704102 2005 L1 augments cell migration and tumor growth but not beta3 integrin expression in ovarian carcinomas.
15653271 2005 Case-control association study of the close homologue of L1 (CHL1) gene and schizophrenia in the Chinese population.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11986985 2002 An association between a missense polymorphism in the close homologue of L1 (CHL1, CALL) gene and schizophrenia.
10508992 1999 CALL gene is haploinsufficient in a 3p- syndrome patient.
9799093 1998 In silico-initiated cloning and molecular characterization of a novel human member of the L1 gene family of neural cell adhesion molecules.