Property Summary

Ligand Count 3
NCBI Gene PubMed Count 52
PubMed Score 275.14
PubTator Score 159.42

Knowledge Summary

Patent (30,263)

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Spinal Dysraphism 12 0.0 0.0
Disease Target Count
spina bifida 1074
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Cancer 2499 4.284 2.1

Expression

  Differential Expression (8)

Disease log2 FC p
ependymoma 1.200 2.4e-02
esophageal adenocarcinoma 1.100 2.0e-02
lung cancer 1.800 3.0e-05
malignant mesothelioma 3.300 1.1e-08
osteosarcoma -1.677 8.4e-06
pancreatic ductal adenocarcinoma liver m... 1.041 3.4e-02
Pick disease -1.400 4.4e-05
ulcerative colitis -1.200 5.3e-06

PDB (18)

Gene RIF (42)

AA Sequence

MKTKFCTGGEAEPSPLGLLLSCGSGSAAPAPGVGQQRDAASDLESKQLGGQQPPLALPPPPPLPLPLPLP      1 - 70
QPPPPQPPADEQPEPRTRRRAYLWCKEFLPGAWRGLREDEFHISVIRGGLSNMLFQCSLPDTTATLGDEP     71 - 140
RKVLLRLYGAILQMRSCNKEGSEQAQKENEFQGAEAMVLESVMFAILAERSLGPKLYGIFPQGRLEQFIP    141 - 210
SRRLDTEELSLPDISAEIAEKMATFHGMKMPFNKEPKWLFGTMEKYLKEVLRIKFTEESRIKKLHKLLSY    211 - 280
NLPLELENLRSLLESTPSPVVFCHNDCQEGNILLLEGRENSEKQKLMLIDFEYSSYNYRGFDIGNHFCEW    281 - 350
MYDYSYEKYPFFRANIRKYPTKKQQLHFISSYLPAFQNDFENLSTEEKSIIKEEMLLEVNRFALASHFLW    351 - 420
GLWSIVQAKISSIEFGYMDYAQARFDAYFHQKRKLGV                                     421 - 457
//

Text Mined References (54)

PMID Year Title