Property Summary

NCBI Gene PubMed Count 49
PubMed Score 267.50
PubTator Score 159.42

Knowledge Summary

Patent (30,263)

TINX Plot

  Disease (3)

Disease Target Count
spina bifida 1064
Disease Target Count Z-score Confidence
Cancer 2346 4.242 2.1

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 3.300 1.1e-08
ependymoma 1.200 2.4e-02
esophageal adenocarcinoma 1.100 2.0e-02
osteosarcoma -1.677 8.4e-06
pancreatic ductal adenocarcinoma liver m... 1.041 3.4e-02
lung cancer 1.800 3.0e-05
Pick disease -1.400 4.4e-05
ulcerative colitis -1.200 5.3e-06

Gene RIF (39)

PMID Text
26769123 Study shows increased CHKA expression in pancreatic ductal adenocarcinoma tumors and may be a predictive marker of response to chemotherapy.
26657335 CHKA can act as an AR chaperone, providing, to our knowledge, the first evidence for kinases as molecular chaperones, making CHKA both a marker of tumor progression and a potential therapeutic target for PCa.
26503172 These data also support the approach of antitumor strategies that destabilize Chk-alpha protein or downregulate PtdCho in breast cancer treatment.
26496360 Downregulation of choline kinase-alpha enhances autophagy in tamoxifen-resistant breast cancer cells.
26041862 Increased expression of CHKA is seen in malignant lesions of prostate cancer
25796169 Identify choline kinase alpha as a key regulator of glutathione-dependent antioxidant cell defense in ovarian carcinoma.
25768400 Chokalpha possessed oncogenic activity and could be a potential therapeutic target in T-cell lymphoma , as well as other hematological malignancies with interrupted Ras signaling pathways
25522435 there is a role for the ChoKalpha protein in promoting cancer cell survival that is independent of its catalytic activity.
25267063 The significance of CHKA overexpression on a TMA.
25028471 choline kinase alpha is inhibited by a near-infrared fluorescent carbocyanine
24583375 Our data suggest that choline kinase and its product phosphocholine are required for the normal growth and mineralization of MG-63 cells.
24556997 Downregulation of Chk-alpha with siRNA increased PLD1 expression, and downregulation of PLD1 increased Chk-alpha expression.
24287694 pharmacological inhibition of ChoKalpha induces cancer cell death through a mechanism that involves the activation of exaggerated and persistent ER stress supported by CHOP overproduction.
24281000 In EOC that CHKA downregulation significantly decreased the aggressive EOC cell.
23775813 Chk-alpha expression and the effect of its downregulation in human umbilical vein endothelial cells, is reported.
23762272 High choline kinase A expression is associated with colorectal cancer.
23416529 A combination of initial velocity and product inhibition studies, together with the kinetic and structural characterisation of a novel ChoKalpha inhibitor is used to support a mechanism of action for human ChoKalpha.
23071593 HK2 and CKA expression may have biologic and prognostic significance in hepatocellular carcinoma, with tumor HK2 expression being a potential independent predictor of survival.
22972156 CHKA SNPs (rs3794186 and rs11481) are not associated with HCC development; however, rs3794186 may correlate with serum AFP levels in HCC.
22515519 ASAH1 inhibition synergistically sensitizes lung cancer cells resistant to the antiproliferative effect of choline kinase alpha inhibitors.
22038995 Data show choline kinase alpha (CHKalpha) expressed in both cytoplasm and nucleus in malignant lesions.
21822308 these results strongly implicate a new c-Src-dependent link between CHKA and EGFR, which contributes to the regulation of cell proliferation and tumorigenesis.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20662904 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20299452 kinetic studies revealed that HC-3 is a much more potent inhibitor for ChoKalpha isoforms (alpha1 and alpha2) compared with ChoKbeta.
20042122 From our data, we proposed that Choline kinase plays a key role in regulating Akt(ser473) phosphorylation, thereby promoting cell survival and proliferation
19915674 ChoKalpha and ChoKbeta isoforms have different physiological roles and implications in human carcinogenesis
19855431 Data show that RNA silencing of choline kinase in HeLa cells completely abrogates the high concentration of phosphocholine, which in turn decreases phosphatidylcholine, phosphatidic acid and signaling through the MAPK and PI3K/AKT pathways.
19737740 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19448670 ChoKalpha plays a role in the aggressiveness of bladder tumors and constitutes a new approach for bladder cancer treatment.
19156696 The rates of choline kinase reaction in cell lysates of MDA-MB-231 breast, PC-3 prostate and HeLa cervical cancer cells and in solutions of purified human ChoK, was measured.
18296102 The molecular basis to understand the connection between phospholipids metabolism and cell cycle regulation through choline kinase is reported.
18172309 These data suggest that HIF-1 activation of HREs within the putative chk-a promoter region can increase Chk-A expression within hypoxic environments, consequently increasing cellular PC and tCho levels within these environments.
17184542 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17184542 Analyses showed genotype effects of CHKA genes on spina bifida risk, but did not show evidence of gene-nutrient.
16820874 ChoK may have a role in carcinogenesis
12176020 upregulation of choline kinase is a frequent feature in human tumor-derived cell lines and in lung, prostate, and colorectal cancers
12082619 ChoK overexpression was found in 17% of the samples. ChoK may be related to the development of human breast cancer, suggesting that this finding may suggest a novel antitumoral strategy.
11840339 activity regulated by Ras proteins through Ral-GDS and PI-3-kinase; has role in malignant transformation

AA Sequence

MKTKFCTGGEAEPSPLGLLLSCGSGSAAPAPGVGQQRDAASDLESKQLGGQQPPLALPPPPPLPLPLPLP      1 - 70
QPPPPQPPADEQPEPRTRRRAYLWCKEFLPGAWRGLREDEFHISVIRGGLSNMLFQCSLPDTTATLGDEP     71 - 140
RKVLLRLYGAILQMRSCNKEGSEQAQKENEFQGAEAMVLESVMFAILAERSLGPKLYGIFPQGRLEQFIP    141 - 210
SRRLDTEELSLPDISAEIAEKMATFHGMKMPFNKEPKWLFGTMEKYLKEVLRIKFTEESRIKKLHKLLSY    211 - 280
NLPLELENLRSLLESTPSPVVFCHNDCQEGNILLLEGRENSEKQKLMLIDFEYSSYNYRGFDIGNHFCEW    281 - 350
MYDYSYEKYPFFRANIRKYPTKKQQLHFISSYLPAFQNDFENLSTEEKSIIKEEMLLEVNRFALASHFLW    351 - 420
GLWSIVQAKISSIEFGYMDYAQARFDAYFHQKRKLGV                                     421 - 457
//

Text Mined References (51)

PMID Year Title
26769123 2016 Choline Kinase Alpha (CHK?) as a Therapeutic Target in Pancreatic Ductal Adenocarcinoma: Expression, Predictive Value, and Sensitivity to Inhibitors.
26657335 2016 Choline Kinase Alpha as an Androgen Receptor Chaperone and Prostate Cancer Therapeutic Target.
26503172 2015 Choline kinase-? protein and phosphatidylcholine but not phosphocholine are required for breast cancer cell survival.
26496360 2015 Downregulation of Choline Kinase-Alpha Enhances Autophagy in Tamoxifen-Resistant Breast Cancer Cells.
26041862 2015 Exploiting altered patterns of choline kinase-alpha expression on human prostate tissue to prognosticate prostate cancer.
25796169 2015 Global metabolic profile identifies choline kinase alpha as a key regulator of glutathione-dependent antioxidant cell defense in ovarian carcinoma.
25768400 2015 Dysregulated choline metabolism in T-cell lymphoma: role of choline kinase-? and therapeutic targeting.
25522435 2013 A non-catalytic role of choline kinase alpha is important in promoting cancer cell survival.
25267063 2014 Alterations of choline phospholipid metabolism in endometrial cancer are caused by choline kinase alpha overexpression and a hyperactivated deacylation pathway.
25028471 2014 Direct inhibition of choline kinase by a near-infrared fluorescent carbocyanine.
24583375 2014 Phosphatidylcholine metabolism and choline kinase in human osteoblasts.
24556997 2014 Phospholipase D1 and choline kinase-? are interactive targets in breast cancer.
24287694 2013 Choline kinase inhibition induces exacerbated endoplasmic reticulum stress and triggers apoptosis via CHOP in cancer cells.
24281000 2014 Choline kinase-alpha by regulating cell aggressiveness and drug sensitivity is a potential druggable target for ovarian cancer.
23775813 2013 Characterization of choline kinase in human endothelial cells.
23762272 2013 Combined 5-FU and ChoK? inhibitors as a new alternative therapy of colorectal cancer: evidence in human tumor-derived cell lines and mouse xenografts.
23416529 2013 Kinetic and mechanistic characterisation of Choline Kinase-?.
23071593 2012 Choline kinase alpha and hexokinase-2 protein expression in hepatocellular carcinoma: association with survival.
22972156 2012 Association of CHKA polymorphism (rs3794186) with ?-fetoprotein levels in hepatocellular carcinoma.
22515519 2012 Acid ceramidase as a chemotherapeutic target to overcome resistance to the antitumoral effect of choline kinase ? inhibition.
22038995 2011 Use of [11C]choline PET-CT as a noninvasive method for detecting pelvic lymph node status from prostate cancer and relationship with choline kinase expression.
21822308 2012 Functional interactions between Choline kinase ?, epidermal growth factor receptor and c-Src in breast cancer cell proliferation.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20662904 2010 Polymorphisms located in the region containing BHMT and BHMT2 genes as maternal protective factors for orofacial clefts.
20299452 2010 Crystal structures of human choline kinase isoforms in complex with hemicholinium-3: single amino acid near the active site influences inhibitor sensitivity.
20042122 2009 Regulation of Akt(ser473) phosphorylation by choline kinase in breast carcinoma cells.
19915674 2009 Differential role of human choline kinase alpha and beta enzymes in lipid metabolism: implications in cancer onset and treatment.
19855431 2010 Selective inhibition of choline kinase simultaneously attenuates MAPK and PI3K/AKT signaling.
19737740 2010 Associations of folate and choline metabolism gene polymorphisms with orofacial clefts.
19448670 2009 A critical role for choline kinase-alpha in the aggressiveness of bladder carcinomas.
19156696 2009 Modulation of choline kinase activity in human cancer cells observed by dynamic 31P NMR.
18296102 2008 Choline kinase as a link connecting phospholipid metabolism and cell cycle regulation: implications in cancer therapy.
18172309 2008 Hypoxia regulates choline kinase expression through hypoxia-inducible factor-1 alpha signaling in a human prostate cancer model.
17184542 2006 CHKA and PCYT1A gene polymorphisms, choline intake and spina bifida risk in a California population.
17007874 2006 Elucidation of human choline kinase crystal structures in complex with the products ADP or phosphocholine.
16820874 2006 Generation and characterization of monoclonal antibodies against choline kinase alpha and their potential use as diagnostic tools in cancer.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15003397 2004 Structure and function of choline kinase isoforms in mammalian cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12176020 2002 Overexpression of choline kinase is a frequent feature in human tumor-derived cell lines and in lung, prostate, and colorectal human cancers.
12062430 2002 Identification of casein kinase Ialpha interacting protein partners.
11840339 2002 Regulation of choline kinase activity by Ras proteins involves Ral-GDS and PI3K.
10363580 1999 Increased choline kinase activity and elevated phosphocholine levels in human colon cancer.
9113621 1997 Phospholipid biosynthetic enzymes in human brain.
9038210 1997 Direct association of Csk homologous kinase (CHK) with the diphosphorylated site Tyr568/570 of the activated c-KIT in megakaryocytes.
8069533 1994 Lymphocyte activation-31P magnetic resonance studies of energy metabolism and phospholipid pathways.
1618328 1992 Cloning of a human choline kinase cDNA by complementation of the yeast cki mutation.
208357 1978 Choline and ethanolamine kinase activity in the cytoplasm of nerve endings from rat forebrain.
36885 1979 Choline kinase and ethanolamine kinase activity in the cytosol of nerve endings from rat forebrain.