Property Summary

NCBI Gene PubMed Count 18
PubMed Score 6.90
PubTator Score 7.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.303 3.2e-04
tuberculosis 1.200 7.3e-07
intraductal papillary-mucinous neoplasm ... -1.300 2.5e-03

Gene RIF (5)

PMID Text
26733160 This review comprehensively analyzes recent data about expression pattern, and involvement of human YKL-40, YKL-39 and SI-CLP in cancer. [review]
24470346 stabilin-1-interacting chitinase-like protein functions as a regulator of the inflammatory response in rheumatoid arthritis by macrophages.
20724479 Structure of human stabilin-1 interacting chitinase-like protein (SI-CLP) reveals a saccharide-binding cleft with lower sugar-binding selectivity.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19275751 The crystals of SI-CLP belong to the space group P3(2)21 with unit cell parameters a=b=99.79 A, c=250.53 A, alpha=beta=90 degrees, gamma=120 degrees.

AA Sequence

MRTLFNLLWLALACSPVHTTLSKSDAKKAASKTLLEKSQFSDKPVQDRGLVVTDLKAESVVLEHRSYCSA      1 - 70
KARDRHFAGDVLGYVTPWNSHGYDVTKVFGSKFTQISPVWLQLKRRGREMFEVTGLHDVDQGWMRAVRKH     71 - 140
AKGLHIVPRLLFEDWTYDDFRNVLDSEDEIEELSKTVVQVAKNQHFDGFVVEVWNQLLSQKRVGLIHMLT    141 - 210
HLAEALHQARLLALLVIPPAITPGTDQLGMFTHKEFEQLAPVLDGFSLMTYDYSTAHQPGPNAPLSWVRA    211 - 280
CVQVLDPKSKWRSKILLGLNFYGMDYATSKDAREPVVGARYIQTLKDHRPRMVWDSQASEHFFEYKKSRS    281 - 350
GRHVVFYPTLKSLQVRLELARELGVGVSIWELGQGLDYFYDLL                               351 - 393
//

Text Mined References (20)

PMID Year Title
26733160 2016 Role of chitinase-like proteins in cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25241909 2014 Genetic susceptibility for chronic bronchitis in chronic obstructive pulmonary disease.
24470346 2014 Human secreted stabilin-1-interacting chitinase-like protein aggravates the inflammation associated with rheumatoid arthritis and is a potential macrophage inflammatory regulator in rodents.
23558346 2013 New paralogues and revised time line in the expansion of the vertebrate GH18 family.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
20724479 2010 Structure of human stabilin-1 interacting chitinase-like protein (SI-CLP) reveals a saccharide-binding cleft with lower sugar-binding selectivity.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19946888 2010 Defining the membrane proteome of NK cells.
19275751 2009 Crystallization and preliminary X-ray crystallographic studies on SI-CLP, a novel human Glyco_18 domain-containing protein.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16357325 2006 Novel stabilin-1 interacting chitinase-like protein (SI-CLP) is up-regulated in alternatively activated macrophages and secreted via lysosomal pathway.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.