Property Summary

NCBI Gene PubMed Count 33
PubMed Score 419.68
PubTator Score 197.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (4)

Disease log2 FC p
non-small cell lung cancer -1.717 1.6e-15
lung cancer -2.100 2.7e-04
lung carcinoma -1.100 9.9e-07
gastric carcinoma -5.400 2.0e-02

Gene RIF (29)

PMID Text
24903994 These data provide the experimental evidence that telomere shortening and related inflammatory proteins are associated with human IgAN, and it could be a new direction for the disease progression study.
24119614 loss of acidic chitinase expression is a promising marker for corpus atrophy
23129258 results showed that the expression of AMCase and CHIT-1 were differently modulated in monocyte macrophages at different stage of maturation. The behavior of these two active chitinase suggests that in the immune response their role is complementary.
22200767 study demonstrated genetic associations between chitinase gene variants and lung function level and rate of decline in chronic obstructive pulmonary disease patients from the Lung Health Study; also functional effect of the rs3818822 polymorphism on AMCase levels and activity was demonstrated
21711963 increased chitinolytic activity in nasal polyps
21511453 A ten base pair insertion in the second exon in the 5'UTR region of the AMCase gene may modify the gene expression and thus may affect the severity of asthma.
21303604 AMCase and eotaxin-3 may be important mediators in the pathogenesis of nasal polyps. The increased AMCase and eotaxin-3 might lead to nasal polyp formation and growth.
21159721 Report increased CSF chitinase levels in patients with neuromyelitis optica and relapsing remitting multiple sclerosis.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20538957 Environmental exposure to fungi does not modify the effect of CHIA SNPs on severe asthma exacerbations
20503287 Observational study of gene-disease association. (HuGE Navigator)
20444155 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20422678 The levels of expression of AMCase and chitotriosidase mRNAs and proteins were increased in allergic turbinate mucosa compared with normal turbinate mucosa.
20226308 Our study found no associations between single nucleotide polymorphisms in the genes CHIT1, CHIA, and CHI3L1 and asthma, changes in lung physiology, or allergy-related phenotypes in subjects with mild-to-moderate asthma
20226308 Observational study of gene-disease association. (HuGE Navigator)
19644363 novel asthma susceptibility genes; review of genetic and fuctional studies
19435888 Genetic association analyses of AMCase haplotypes for asthma revealed significant protective associations between the variant haplotype in several asthma cohorts.
19379605 The abundant biopolymer chitin appears to be recognized by a yet uncharacterized receptor on sinonasal epithelial cells. Chitin stimulates production of AMCase and eotaxin-3, two pro-Th2 effector proteins.
19342690 secreted AMCase feeds back in an autocrine and/or paracrine manner to protect pulmonary epithelial cells from growth factor withdrawal- and Fas ligand-induced apoptosis
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19247692 Observational study of gene-disease association. (HuGE Navigator)
19242357 Results showed the presence of CHIT1 and AMCase mRNA in gastric mucosa and the correlation with the presence of H. pylori was significant only for CHIT1 but not for AMCase expression.
19085022 The three-dimensional (3D) model of the human acidic mammalian chitinase (hAMCase) was constructed based on the crystal structure of the human chitotriosidase (EC 3.2.1.44, PDB code 1HKK) by using InsightII/Homology module.
18824549 lung epithelial cells secrete AMCase via an EGFR-dependent pathway that is activated by ADAM17 and mediates its effects via Ras.
18602573 results establish a significant association of CHIA with atopic asthma and serum total IgE levels in the Indian population
18602573 Observational study of gene-disease association. (HuGE Navigator)
17703412 Observational study of gene-disease association. (HuGE Navigator)
16584180 human AMCase has only one pH optimum for k(cat)/K(m) between pH 4 and 5. Steady state kinetics shows that human AMCase has "low" intrinsic transglycosidase activity, which leads to the observation of apparent substrate inhibition.
15192232 expressed in exaggerated quantities in human asthma

AA Sequence

MTKLILLTGLVLILNLQLGSAYQLTCYFTNWAQYRPGLGRFMPDNIDPCLCTHLIYAFAGRQNNEITTIE      1 - 70
WNDVTLYQAFNGLKNKNSQLKTLLAIGGWNFGTAPFTAMVSTPENRQTFITSVIKFLRQYEFDGLDFDWE     71 - 140
YPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVM    141 - 210
TYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTG    211 - 280
IGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNIKSFDIKAQWLK    281 - 350
HNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPAQPIEPITAAPSGSGNGSGSSSS    351 - 420
GGSSGGSGFCAVRANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNWA                  421 - 476
//

Text Mined References (35)

PMID Year Title
25338677 Genetic analysis of the pathogenic molecular sub-phenotype interferon-alpha identifies multiple novel loci involved in systemic lupus erythematosus.
24903994 2014 Proteins induced by telomere dysfunction are associated with human IgA nephropathy.
24119614 2013 Transcriptome signatures in Helicobacter pylori-infected mucosa identifies acidic mammalian chitinase loss as a corpus atrophy marker.
23129258 2013 Evaluation of AMCase and CHIT-1 expression in monocyte macrophages lineage.
22200767 2012 Genetic association between human chitinases and lung function in COPD.
21711963 Chitinolytic activity in nasal polyps.
21511453 2011 The effects of an insertion in the 5'UTR of the AMCase on gene expression and pulmonary functions.
21303604 2011 Expression and role of acidic mammalian chitinase and eotaxin-3 in chronic rhinosinusitis with nasal polyps.
21159721 2011 Chitinase effects on immune cell response in neuromyelitis optica and multiple sclerosis.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20538957 2010 Fungal exposure modulates the effect of polymorphisms of chitinases on emergency department visits and hospitalizations.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20444155 2010 Joint influences of Acidic-Mammalian-Chitinase with Interleukin-4 and Toll-like receptor-10 with Interleukin-13 in the genetics of asthma.
20422678 2010 Increased expression of acidic mammalian chitinase and chitotriosidase in the nasal mucosa of patients with allergic rhinitis.
20226308 2010 Polymorphisms of chitinases are not associated with asthma.
19644363 2009 The chitinase and chitinase-like proteins: a review of genetic and functional studies in asthma and immune-mediated diseases.
19435888 2009 Differential enzymatic activity of common haplotypic versions of the human acidic Mammalian chitinase protein.
19379605 Chitin stimulates expression of acidic mammalian chitinase and eotaxin-3 by human sinonasal epithelial cells in vitro.
19342690 2009 Acidic mammalian chitinase regulates epithelial cell apoptosis via a chitinolytic-independent mechanism.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19247692 2009 Analyses of associations with asthma in four asthma population samples from Canada and Australia.
19242357 2009 CHIT1 and AMCase expression in human gastric mucosa: correlation with inflammation and Helicobacter pylori infection.
19241384 2009 Triad of polar residues implicated in pH specificity of acidic mammalian chitinase.
19085022 2009 Analysis of a three-dimensional structure of human acidic mammalian chitinase obtained by homology modeling and ligand binding studies.
18824549 2008 Acidic mammalian chitinase is secreted via an ADAM17/epidermal growth factor receptor-dependent pathway and stimulates chemokine production by pulmonary epithelial cells.
18602573 2008 Genetic association of acidic mammalian chitinase with atopic asthma and serum total IgE levels.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16584180 2006 Kinetic characterization of recombinant human acidic mammalian chitinase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15192232 2004 Acidic mammalian chitinase in asthmatic Th2 inflammation and IL-13 pathway activation.
12971947 2003 Immunohistochemical demonstration of acidic mammalian chitinase in the mouse salivary gland and gastric mucosa.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11085997 2001 Identification of a novel acidic mammalian chitinase distinct from chitotriosidase.
10548734 1999 Isolation and mapping of a human lung-specific gene, TSA1902, encoding a novel chitinase family member.