Property Summary

Ligand Count 4
NCBI Gene PubMed Count 35
PubMed Score 475.27
PubTator Score 197.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Abortion, Spontaneous 109 0.0 0.0
Disease Target Count
Spontaneous abortion 113
Disease Target Count P-value
non-small cell lung cancer 2890 1.6e-15
lung carcinoma 2843 9.9e-07
lung cancer 4740 2.7e-04
gastric carcinoma 807 2.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (4)

Disease log2 FC p
gastric carcinoma -5.400 2.0e-02
lung cancer -2.100 2.7e-04
lung carcinoma -1.100 9.9e-07
non-small cell lung cancer -1.717 1.6e-15

Gene RIF (31)

AA Sequence

MTKLILLTGLVLILNLQLGSAYQLTCYFTNWAQYRPGLGRFMPDNIDPCLCTHLIYAFAGRQNNEITTIE      1 - 70
WNDVTLYQAFNGLKNKNSQLKTLLAIGGWNFGTAPFTAMVSTPENRQTFITSVIKFLRQYEFDGLDFDWE     71 - 140
YPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVM    141 - 210
TYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTG    211 - 280
IGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNIKSFDIKAQWLK    281 - 350
HNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPAQPIEPITAAPSGSGNGSGSSSS    351 - 420
GGSSGGSGFCAVRANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNWA                  421 - 476
//

Text Mined References (37)

PMID Year Title