Property Summary

NCBI Gene PubMed Count 287
PubMed Score 668.29
PubTator Score 667.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Obstructive lung disease 1 0.0 2.0
Disease Target Count Z-score Confidence
Asthma 349 4.091 2.0
Disease Target Count
Schizophrenia 503
Disease Target Count
Asthma-related traits 7 1

Expression

  Differential Expression (32)

Disease log2 FC p
glioblastoma 6.200 1.8e-04
malignant mesothelioma -1.300 4.8e-06
osteosarcoma -4.144 8.7e-04
medulloblastoma -3.200 6.6e-05
cystic fibrosis 3.400 4.4e-03
medulloblastoma, large-cell -3.300 8.7e-03
primitive neuroectodermal tumor -2.600 4.4e-02
limb girdle muscular dystrophy 2B 1.070 6.9e-03
acute quadriplegic myopathy 2.264 5.4e-04
pancreatic ductal adenocarcinoma liver m... -3.974 1.0e-03
colon cancer 3.500 7.8e-03
lung cancer -3.500 6.3e-04
Obesity 1.400 3.3e-02
interstitial cystitis 7.900 6.8e-06
lung adenocarcinoma 2.300 1.8e-06
adult high grade glioma 3.800 1.8e-05
pilocytic astrocytoma 3.000 1.1e-03
posterior fossa group A ependymoma 3.400 5.9e-07
nasopharyngeal carcinoma 2.300 3.5e-04
lung carcinoma -2.600 3.7e-16
non-small cell lung carcinoma 1.100 4.9e-12
Breast cancer -3.400 3.1e-07
gastric carcinoma 3.600 3.3e-02
pterygium -1.200 4.8e-02
mucosa-associated lymphoid tissue lympho... 2.977 2.7e-02
ductal carcinoma in situ 2.800 1.6e-02
ulcerative colitis 5.300 1.9e-07
ovarian cancer 4.300 2.0e-06
pituitary cancer -5.000 4.0e-05
chronic rhinosinusitis 2.018 2.7e-02
head and neck cancer 3.000 1.1e-04
head and neck cancer and chronic obstruc... 3.100 2.8e-03

Gene RIF (283)

PMID Text
27152377 serum YKL-40 level in coronary artery disease patients was significantly higher than that in control subjects.
27121858 Increased mRNA level of CHI3L1 could be associated with the progression of astrocytoma and poor patient survival not only for glioblastoma, but for lower grade astrocytoma tumors as well.
27069189 We identified five new biomarkers: GDF15, osteonectin, TRAP5, TWEAK, and YKL40 as being promising markers for monitoring bone metastases.
27013031 YKL-40 expression is up-regulated in patients with COPD and correlates with exacerbation attacks and may contribute to airway remodeling by acting on lung fibroblasts.
26828595 Elevated serum CHI3L1 concentration is an independent prognostic biomarker for poorer survival in lung cancer patients.
26733160 This review comprehensively analyzes recent data about expression pattern, and involvement of human YKL-40, YKL-39 and SI-CLP in cancer. [review]
26698298 Neurogranin and YKL-40 are promising AD biomarkers, independent of and complementary to the established core Alzheimer's disease (AD) biomarkers, reflecting additional pathological changes in the course of AD
26696093 YKL-40 is a potential marker for in vitro cultured pro-inflammatory macrophages and is not a valuable biomarker in serum and sputum of patients with COPD treated with inhaled corticosteroids.
26620310 Ykl-40 expression was significantly lower in the serum of TB patients compared to lung cancer, lung metastasis, pneumonia, and transudate pleural effusion. Pleural Ykl40 was similar among all groups.
26603717 The serum YKL-40 cutoff to identify beta-thalassemia major patients with liver cirrhosis or heart disease was determined.
26523896 Serum YKL-40 level increases with severity of obstructive sleep apnea syndrome (OSAS). The findings suggest that YKL-40 may be a useful biomarker for inflammation in patients with OSAS.
26466985 CHI3L1 is expressed during the process of differentiation and maturation of dendritic cells in time dependent manner, it could play a crucial role in the dendritic cells immune response.
26452028 Data show that the expression of chitinase 3-like 1 (cartilage glycoprotein-39) protein (CHI3L1) was higher in cancerous tissues than in normal tissues.
26427144 YKL-40 in synovial fluid could represent a potential biomarker for assessing the symptomatic severity of knee osteoarthritis.
26415140 CHI3L1 Is a Liver-Enriched, Noninvasive Biomarker That Can Be Used to Stage and Diagnose Substantial Hepatic Fibrosis.
26382922 Conclude that YKL-40 and adiponectin are early inflammatory markers in diabetic subjects even in the presence of a low atherosclerotic background.
26372680 Serum YKL-40 level was examined in patients with asthma and COPD in a European study to evaluate biomarkers for factors that affect chitinase levels in patients with severe airway disease.
26316585 This study clearly indicates that acute aerobic exercise elicits a pro-inflammatory response (e.g. CHI3L1) with a lower anti-inflammatory effect (e.g. ITLN-1) in obese individuals.
26310833 the effect of YKL-40/chitinase-3-like-1 protein-associated inflammation in promoting tumor progression.
26301577 Pregnancy seems to be associated with a temporary reduction in circulating YKL-40, which increases after delivery, but to a much lesser extent in women with GDM than in non-GDM women.
26295543 Study suggests that a newly identified subgroup of SSEA-4 and YKL-40 positive cells constitute a fraction of astroglial progenitors, and suggests the name SYPAP (SSEA-4 and YKL-40 positive astroglial progenitors) for this particular population
26275425 Data show that YKL40 gene is highly expressed in non-small cell lung cancer (NSCLC) specimens and correlates with poor prognosis. Functional analysis suggest that YKL-40 is a major factor in NSCLC metastasis.
26270969 Study shows increased cerebrospinal fluid (CSF) levels of YKL-40 in patients with Alzheimer's disease compared to controls and patients with Parkinson's disease or Dementia with Lewy Bodies suggesting it as biomarker candidate for AD diagnosis.
26197239 serum YKL-40 may have a role in obesity-related low grade inflammation, it is not necessarily directly involved in the development of Type 2 Diabetes
26142786 Studied whether carotid intima-media thickness is associated with serum YKL-40/chitinase 3-like protein 1 levels in patients with normotensive and nondiabetic OSAS.
26125767 YKL-40 and CRP can be used to evaluate the effects of sepsis treatment.
26121745 These data demonstrate that CHI3L1-dependent pathways exacerbate pulmonary fibrosis and suggest CHI3L1 as a potential biomarker for pulmonary fibrosis progression and severity in HPS.
26095694 High plasma YKL-40 levels were associated with high risk of gastrointestinal and likely of lung cance.
26002577 In melanoma patients at stages I-III, the high concentrations of TIMP-1 in serum predicted adverse prognosis. YKL-40 was associated with ulceration of primary tumor, which is a very important prognostic factor
25976273 We also demonstrated that miR-24 suppressed the expression of chitinase 3-like 1 (CHI3L1) mRNA, thought to mediate multiple signaling pathways
25941933 A comprehensive analysis of the relative expression levels of YKL-40 mRNA versus mammalian chitinases in normal human tissues, is reported.
25909875 YKL40-positive glioblastoma multiforme is significantly linked to subventricular zone types of brain neoplasms.
25875173 c-Met and YKL-40 expression is a reliable predictor of partial/absent response to neoadjuvant chemoradiotherapy in rectal cancer.
25760838 CHI3L1 SNPs rs4950928 and rs883125 may be associated with childhood asthma. G allele at rs4950928 may increase the risk of childhood asthma.
25698171 cerebrospinal fluid CHI3L1 and CHI3L2 and serum CHI3L1 might help to define multiple sclerosis disease stage
25688078 Cerebrospinal fluid CHI3L1 was validated as a biomarker associated with clinically isolated syndromes.
25657159 increased YKL-40 and MPV levels might be a prognostic factor for cellulitis in patients.
25629580 Chi3l1 is induced by an HFD and Th2 inflammation, and simultaneously contributes to the genesis of obesity and asthma.
25629266 YKL40 mRNA in glioma patients was over-expressed versus normal brain. Serum YKL-40 concentrations increased with tumour grade and correlated positively with transcript rate, being the highest in glioblastoma.
25624368 Elevated YKL-40 was associated with a 34% increase in triglyceride levels and with a 2-fold increased risk of ischemic stroke.
25592985 These data suggest that SNP rs12141494 modulates YKL-40 expression in the airway and contributes to airway remodeling and asthma severity.
25573204 Serum YKL-40 together with serum CTX-MMP/PINP ratio and World Health Organization status were independent predictors of time to first SRE.
25545245 MMP-8, MMP-9, and YKL-40 might serve as novel non-invasive biomarkers of CF lung disease and pulmonary exacerbations.
25519006 Levels of CHIT1 and YKL-40 in plasma of type 2 diabetic patients increased progressively with the degree of albuminuria.
25497736 Higher serum YKL-40 levels in cystic fibrosis patients are significantly associated with dysglycemia
25486056 Circulating YKL40 level, but not CHI3L1 gene promoter variants, is associated with the risk of peripheral artery disease in Taiwanese.
25421412 YKL-40 can be used as a marker for predicting and preventing cardiovascular diseases in RP psoriatic patients with age above 40.
25412935 Circulating YKL-40 is a valuable tumor marker in the diagnosis of endometrial carcinoma.
25400457 CHI3L1 may contribute to colitis-associated colitis by increasing reactive oxygen species production.
25343670 High CHI3L1 serum levels are associated with disease progression in nonrevascularized coronary artery disease.
25304157 The current results demonstrated that CHI3L1 may be a promising biomarker to identify individuals with poor prognostic potential and a possible target for anti-angiogenic therapy in patients with early stage NSCLC.
25270518 Chitinase 3-like 1 elevation is associated with developing idiopathic pulmonary fibrosis.
25262987 Data indicate that serum YKL-40 protein levels predict clinical outcomes of intracerebral hemorrhage.
25225167 YKL-40 concentration within the top 5% was a marker for alcoholic liver cirrhosis.
25203433 correlation of chitinase 3-like 1 single nucleotide polymorphisms and haplotypes with uterine cervical cancer
25172979 CRP and YKL-40 may have roles as biomarkers in diabetic retinopathy
25172968 serum levels of YKL-40 are elevated in patients with cerebrovascular disease in lesion subtype- and severity-dependent manners
25142236 Increased expression of Chitinase 3-like 1 and microvessel density predicts metastasis and poor prognosis in clear cell renal cell carcinoma.
25139333 A combined profile of preoperative IGFBP-2, GFAP, and YKL-40 plasma levels could serve as an additional diagnostic tool for patients with inoperable brain lesions suggestive of Glioblastoma multiforme.
25128003 Urine YKL-40 is associated with acute kidney injury progression and/or death in hospitalized patients.
25068525 maternal serum levels were lower in women who subsequently developed early or late pre-eclampsia than in those who remained normotensive
25056157 Findings suggest that the CHI3L1 polymorphisms rs1538372 and rs10399931 can be used as genetic markers for predicting asthma risk in the Taiwanese population.
25051073 serum levels of YKL-40 were correlated with body mass index (BMI), homeostasis model assessment of insulin resistance (HOMA-IR), C-reactive protein (CRP), and apnea-hypopnea index (AHI) in patients with OSAS
25047113 In children with falciparum malaria, CHI3L1 levels were increased in those with anemia and cerebral complications. Plasmodium falciparum stimulated CHI3L1 production by human peripheral blood mononuclear cells in vitro.
25024322 The data of this study suggested that CSF YKL-40 levels, although not useful as a diagnostic marker for Prod-AD, may be a valuable marker to detect early physiopathological changes potentially linked with the neurodegenerative process.
25001061 Results indicated that YKL-40 expression is up-regulated in esophageal squamous cell carcinoma.
24996799 Elevated pretreatment serum concentration of YKL-40 is an independent prognostic biomarker for poor survival in patients with colorectal cancer.
24981110 YKL40 plays an important role in prostate cancer progression and thus inhibition of YKL40 may be a potential therapeutic strategy for the treatment of prostate cancer
24958781 SNPs associated YKL-40 levels and incident cardiovascular events
24954373 Severe persistent asthma in childhood is not associated with elevated YKL-40 levels, unlike in adults with severe persistent asthma. YKL-40 is not a useful biomarker for asthma severity in childhood asthma.
24920662 Data demonstrate that high levels of CHI3L1 are associated with lung fibrosis progression in ambulatory patient.
24878721 A measure of decreased VEGF availability, and YKL-40.
24861484 Serum YKL-40 was not associated with preeclampsia. Increasing serum YKL-40 was related to maternal age, body mass index and small-for-gestational age and may reflect an exaggerated inflammatory response.
24842123 Study identified the YKL40 and MAGEC1 genes as temozolomide (TMZ) resistanceassociated biomarkers in the TMZR U87 cell line, which showed an obvious resistance in vivo.
24814404 YKL-40 serum levels are associated with the presence of bladder cancer and poor patients' survival; however, bladder cancer tissue is not the main source of serum YKL-40 levels
24808626 Normal serum levels of YKL-40 indicate stable disease in patients with beta-thalassemia major treated with iron chelating agents.
24801872 YKL-40 was an independent prognostic indicator of PFS.
24730590 HC gp-39 is up-regulated in antigen-specific CD4+CD25+ forkhead box protein 3 (FoxP3)+ regulatory T cells (Treg) in the early induction phase of arthritis.
24729664 CHI3L1 is overexpressed in aorta from patients with atherosclerosis
24691276 Data suggest the crucial role of CHI3L1 by promoting angiogenesis, which may contribute to the development and progression of cervical cancer.
24689875 Increased levels of circulating YKL-40 in myelofibrosis signify disease activity.
24685381 Elevated pretransplant serum YKL-40 concentration is associated with bronchiolitis obliterans development and could be an independent biomarker in early prediction and monitoring of BOS.
24650028 YKL-40 is expressed in soft-tissue sarcomas. There is a correlation between expression of YKL-40 in STS and both histological grade of the malignancy and survival
24582001 CSF levels of YKL-40 were increased in multiple sclerosis during relapse, remission and secondary progression compared to controls.
24572981 ChT and YKL-40 seem to be the more predictable markers of atherosclerosis even in early ages (<6 years old) than other classical inflammation markers such as hs-CRP, IL-6 and TNF-alpha.
24512683 Data suggest that CHI3L1 acts as a myokine; CHI3L1 expression is induced by pro-inflammatory cytokines and counteracts TNFalpha-mediated inflammation/insulin resistance in skeletal muscle involving autocrine/paracrine mechanisms.
24498368 Elevated plasma YKL-40 is associated with response to chemotherapy in metastatic colorectal cancer.
24442412 The significance of YKL-40 protein in liver fibrosis.
24440516 these discoveries reveal a novel and crucial role for both CHIT1 and CHI3L1 in promoting bone resorption
24405178 Serum YKL-40 concentrations were independently and significantly correlated with apnea-hypopnea index scores in patients with obstructive sleep apnea syndrome.
24324091 addition of YKL-40 may improve the specificity of mesothelin measurements alone for detecting patients with MM
24309227 Elevated levels of serum YKL-40 are associated with the presence and severity of CAD in patients with OSAS.
24256818 In conclusion, plasma YKL-40 may play a role in the diagnosis and clinical assessment of CAP severity, which could potentially guide the development of treatment strategies.
24062521 Resequenced the promoter, all 10 exons and exon-flanking intron segments of CHI3L1 in 904 individuals from the Danish general population (n=8899) with extreme plasma YKL-40 levels, adjusted for age; identified 59 genetic variants in CHI3L1.
23918300 YKL-40 expression in breast cancer tissues is associated with hormone receptor negativity and Her-2/neu-enriched molecular subtypes of breast cancer, and therefore could be considered a poor prognostic predictor.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of chitinase 3-like 1 (CHI3L1, cartilage glycoprotein-39) expression by HIV-1 Vpr in Vpr transduced macrophages
23792508 Increased serum YKL-40 levels are independently associated with proteinuria in renal transplant recipients. YKL-40 may be responsible for the pathogenesis of cardiovascular injury in this patient population.
23706599 genotype and plasma levels have prognostic value in patients with systemic inflammatory response syndrome and sepsis
23671604 Data indicate that the synthesis of YKL-40 protein is a marker for mesenchymal stem cells (MSCs) differentiation into mature mesenchymal phenotypes.
23665676 Data suggest that YKL-40 plays a central role in mural cell-mediated tumor angiogenesis.
23628340 YKL-40 levels are increased in children with severe, therapy-resistant asthma compared to healthy children, and also compared to children with controlled asthma following correction for genotype.
23613996 Stat3 downstream gene product chitinase 3-like 1 is elevated in lung cancer
23591413 Biomarkers of inflammation, YKL-40 and C-reactive protein, vary in parallel with the intake of traditional Inuit diet.
23573226 Increased serum YKL-40 level indicates plaque instability and more severe clinical symptoms of carotid atherosclerosis with CagA-positive helicobacter pylori infection.
23562456 YKL-40 is a versatile biomarker involved in inflammatory signaling pathways. [Review]
23551676 Dialysis patients with chronic renal failure have elevated serum YKL-40 concentrations; YKL-40 might be a novel inflammatory marker in this population
23525579 Data indicate that CHI3L1 expression was positively correlated with high level of p-Akt, but inversely correlated with expression of E-cadherin in hepatocellular carcinoma (HCC) tissues.
23501042 the ghrelin-leptin network had an impact on serum YKL-40 levels in obese prepubertal children; upregulation of YKL-40 secretion seems to be a consequence of reduced ghrelin rather than elevated leptin concentrations
23490418 The coexistence of anti-hepatitis C virus seropositivity had an important impact on plasma YKL-40 levels in hemodialysis patients particularly those with cardiovascular complications.
23397672 YKL-40 levels increased immediately in induced sputums
23364142 Circulating YKL-40 levels could be a biomarker for hypoxemia and decline in lung function.
23294528 Serum YKL-40 predicts long-term mortality in patients with stable coronary disease.
23291472 In samples from patients undergoing deceased-donor kidney transplant, we found higher levels of the orthologous human protein, YKL-40, in urine and blood from allografts subjected to sufficient peri-transplant ischemia to cause delayed graft function.
23279705 The (-131CG) genotype was not associated with increased risk of atrial fibrillation
23272150 serial changes in serum YKL-40 levels immediately following AIS and provide the first evidence that it is a valid indicator of AIS extent and an early predictor of functional outcome.
23227243 This study aimed to investigate the association between serum YKL-40 and prognosis of breast cancer in a Chinese population.
23226395 miRNA-449a plays an important role in modulating expression of YKL40 through targeting the components of the NOTCH signaling pathway following hepatitis C virus infection.
23197259 YKL-40 may be involved in the inflammation of asthma by induction of IL-8 from epithelium, subsequently contributing to bronchial smooth muscle cell proliferation and migration.
23190377 A significant correlation with the genotypes in CHI3L1/YKL-40 was observed in the context of stress and asthma severity.
23170831 we have concisely summarized the cellular and molecular mechanisms underlining the development of IBD and colitis-associated cancer, with particular focus on the TLR4- and CHI3L1-signaling pathways in CECs.
23149946 We found that during the maturation of monocytes into macrophages, the expression of both CHI3L-1 and CHIT-1 increased exponentially over time.
23071724 Serum YKL-40 correlates with triglyceride levels in a representative group of the general Danish population.
22989351 we demonstrated that genetic factors such as YKL-40-polymorphism (rs4950928; G/C) and gender may affect immunologic processes leading to acute cellular rejection and accelerate fibrosis development after LT for HCV-related end-stage liver disease.
22986489 Serum YKL-40 levels were elevated in type 1 diabetic patients and associated with increasing level of albuminuria.
22955689 We found that serum YKL-40 is related to older age, increased admission glucose levels, leukocyte counts and decreased hemoglobin levels; YKL-40 level and leukocyte count independently predicted MACE.
22937056 Variations of CHI3L1, levels of the encoded glycoprotein YKL-40 and prediction of fatal and non-fatal ischemic stroke.
22809439 YKL-40 was associated with several cardiovascular disease risk factors and was elevated in type 2 diabetic patients with suspected coronary artery stensosis on coronary artery disease.
22655594 When biological aggressiveness is taken into account, YKL-40 expression was found to be an independent prognostic factor that predicts OS better than MGMT status.
22647735 Patients with chronic pancreatitis and secondary diabetes mellitus has elevated levels of YKL-40 and IL-6 as compared with those in chronic pancreatitis patients with normal glucose tolerance.
22642467 YKL-40 levels are elevated in essential hypertension subjects with an independent association between increasing YKL-40 levels and increasing arterial stiffness.
22628227 Results revealed that levels of plasma YKL-40 were significantly elevated in patients with PID as compared to those in controls.
22583189 plasma chitinase-3-like protein 1(YKL-40) levels increased in patients with polycystic ovary syndrome (PCOS) and levels above the cut-off point may help the clinician to predict abnormal glucose tolerance in patients with PCOS
22572101 YKL-40 is higher in subjects with peripheral arterial disease. YKL-40 was higher in PAD patients with pre-/diabetes.
22554524 This study indicates that CHI3L1 is involved in hyperoxia-induced cell death, suggesting that CHI3L1 may be one of several cell death regulators influencing the MAPK and PI3K pathways during oxidative stress in human airway epithelial cells.
22534532 rs4950928 and rs10399931 promoter polymorphisms in CHI3L1 are equally likely to modulate CHI3L1 expression and susceptibility to asthma in Caucasian and African populations.
22525348 Elevated plasma YKL-40 levels were associated with increased risk of atrial fibrillation.
22480951 Serum YKL-40 levels are highest during pneumonia compared to common pulmonary/pleural diseases and are more useful for monitoring pneumonia than asthma
22433444 rs10399931 is not associated with clinical phenotypes of coronary heart disease (CHD) and the extent of coronary lesions; however, YKL-40 levels are higher in CHD patients and associated with its clinical phenotypes.
22366530 These findings suggest possible associations between the SNP in the CHI3L1 gene, the risk for schizophrenia, and higher serum YKL-40 levels and personality traits in a Japanese population.
22351690 Increased CHI3L1 protein levels in sera are associated with colorectal cancer.
22281830 role in bronchial smooth muscle remodeling in asthma via PAR-2-dependent mechanism
22211103 ERK1/2 phosphorylation by CHI3L1 leads to a proliferative signal.
22209156 Serum YKL-40 is significantly associated with all-cause mortality in patients with heart failure and could potentially be a new prognostic biomarker in these patients.
22209020 In patients with T2D and increasing albuminuria high YKL-40 levels predict all-cause mortality.
22183936 These findings point to a role of CHI3L1 in patients with progressive forms of multiple sclerosis, particularly in those with primary progressive disease
22146624 YKL-40 is highly expressed in HCC at the molecular, cellular and tissue levels. However, it may not serve as a serum biomarker for HCC because measurement of the serum YKL-40 level cannot distinguish HCC from cirrhosis.
22140133 YKL-40 may be important in initial cell differentiation from hESCs toward ectoderm and neuroectoderm
22103814 YKL-40 promotor polymorphism is not associated with disease progression in chronic hepatitis C patients with established fibrosis.
22095223 Elevated YKL-40 levels are associated with increased risk of gastrointestinal cancer, independently of CRP levels, whereas elevated CRP levels are associated with increased risk of lung cancer, independently of YKL-40 levels
22074331 This study characterized the factors that regulate YKL-40 expression in macrophages and astrocytes and studied whether YKL-40 expression correlates with cell morphology and/or activation state
22056877 CHI3L1 expressed in colon cancer cells promotes cancer cell proliferation, macrophage recruitment and angiogenesis
22036069 YKL-40 levels are elevated in obese youth and represent a marker of insulin resistance even in childhood.
21978279 Expression levels of phospho-AKT and phospho-ERK kinase do not correlate with YKL40 phosphorylation as in adults.
21968467 Elevated sputum YKL-40 reflects airflow obstruction in asthma whereas the roles of YKL-40 in the proximal airways in COPD remains to be elucidated.
21953450 NFI-X3 and STAT3 control the migration of differentiating astrocytes as well as migration and invasion of glioma cells via regulating YKL-40 expression.
21949714 YKL-40/BRP-39 levels are increased in human and murine CF airway fluids
21934681 data demonstrate that expression levels of YKL-40 are associated with tumour grade, poor differentiation, and other breast cancer markers, highlighting that tissue levels of YKL-40 serve as a valuable biomarker for breast cancer diagnosis and prognosis
21858537 Data show that YKL-40 levels did not differentiate patients with advanced melanoma from controls.
21831900 High serum YKL-40 is associated with high-grade gliomas.
21820815 The obtained data suggest an overt prominence of TKL-40 tissue immunoexpression of YKL-40 in high-grade serous ovarian tumors.
21782391 YKL-40 (chitinase 3-like-1) has a role in psoriasis vulgaris and pustular psoriasis
21715039 Both YKL-40 and leptin levels were found to be significantly positively correlated with each other in obese subjects whether diabetic or non diabetic.
21714862 We suggest that the g.-131(C > G) promoter polymorphism has a substantial impact on serum concentrations of YKL-40 in patients with rheumatoid arthritis and healthy subjects, however, the polymorphism does not seem to confer risk to RA itself.
21642896 CHI3L1 contains cis-acting variation but is subject to tissue-specific regulation.
21530869 CHI3L1 single-nucleotide polymorphism rs4950928 (131C>G) is significantly associated with asthma-related hospital admissions in children and young adults with asthma.
21496058 YKL-40 may be associated with Food allergy airway allergic responses.
21478032 These data demonstrate that IL-6, but not TNF-alpha, has a key-role in the regulation of plasma YKL-40 levels during inflammation.
21391238 Longitudinal increase in serum levels of YKL-40, but not MMP-9, predicts survival in patients with primary central nervous system lymphoma.
21385870 mechanisms by which YKL-40 promotes tumor angiogenesis and malignancy
21272568 Plasma YKL-40 increases with age within and across healthy individuals from the general population
21258804 Maintenance of YKL-40 level in mud pack therapy seems to slow down the progression of knee osteoarthritis.
21257319 CHI3L1-329G>A and -131G>C polymorphisms are associated with serum YKL-40 levels, but not with the prevalence or severity of coronary artery disease
21159721 Report increased CSF chitinase levels in patients with neuromyelitis optica and relapsing remitting multiple sclerosis.
21159401 Analyses demonstrated that serum YKL-40 level was a determinant of albuminuria independently of conventional risk factors.
21143859 Report increased YKL-40 levels in patients with type 2 diabetes and/or ischemic heart disease.
21029458 Resveratrol represses YKL-40 expression in vitro; the ERK1/2 pathway is involved in this repression
20972697 Data show that CRP, but not YKL-40, is associated with the cholesterol levels in statin treated patients.
20961744 mRNA levels of the novel inflammatory factors lipocalin-2, chitinase-3 like-1 and osteopontin are increased in human visceral abdominal tissue of subjects with colon cancer.
20943784 association of YKL-40 mRNA and protein levels in visceral adipose tissue with its circulating concentrations indicates an important contribution of VAT in YKL-40 regulation. data suggest a role of glucose metabolism and inflammation on YKL-40 regulation.
20926018 High YKL-40 immuno reactivity in endometrial cancer may be associated with poor prognosis.
20840668 Serum and urine levels of YKL-40 may be used as non-invasive biomarkers in Bladder pain syndrome/interstitial cystitis for the evaluation of bladder fibrogenesis.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20674561 2122C>T of CHI3L1, a promoter single nucleotide polymorphisms which affects the mRNA expression and nuclear factor binding, is significantly associated with serum LDL cholesterol levels in Korean subjects.
20674561 Observational study of gene-disease association. (HuGE Navigator)
20656949 breast regression protein-39 has a role in the pathogenesis of cigarette smoke-induced inflammation and emphysema
20650887 mechanical stress potently induces CHI3L1 expression leading to increased secretion of YKL-40 protein in an EGFR and MEK1/2-dependent pathway.
20640910 analysis of interleukin-6, vascular endothelial growth factor, YKL-40, matrix metalloproteinase-3, and total aggrecan in spondyloarthritis patients during 3 years of treatment with TNFalpha inhibitors
20540736 Data demonstrate that CHI3L1 is induced in astrocytes in a variety of neurological diseases but that it is most abundantly associated with astrocytes in regions of inflammatory cells.
20538957 Environmental exposure to fungi does not modify the effect of CHI3L1 SNPs on severe asthma exacerbations
20506295 HYAL1 overexpression is correlated with the gliomas.
20499402 YKL-40 expression status correlated well with the pathologic grade of primary astrocytomas; current results also indicted that YKL-40 plays a pivotal role in glioma cell proliferation through activation of the MAPK and AKT pathways
20424473 Observational study of gene-disease association. (HuGE Navigator)
20356987 YKL-40 is found in increased quantities in the serum of Chinese patients with asthma, and its level correlates with exacerbation attacks, indicating that high levels of serum YKL-40 may be a biological characteristic of the exacerbation of asthma
20347092 YKL-40 might have a role in plaque instability, potentially reflecting macrophage activation and matrix degradation within the atherosclerotic lesion
20300754 CHI3L1 SNPs, shown to be involved in the predisposition of schizophrenia, are not associated with rheumatoid arthritis.
20300754 Observational study of gene-disease association. (HuGE Navigator)
20237129 Cerebrospinal fluid chitinase 3-like 1 levels are increased in patients who convert to multiple sclerosis (MS) compared with patients who will not convert to MS.
20226308 Our study found no associations between single nucleotide polymorphisms in the genes CHIT1, CHIA, and CHI3L1 and asthma, changes in lung physiology, or allergy-related phenotypes in subjects with mild-to-moderate asthma
20226308 Observational study of gene-disease association. (HuGE Navigator)
20224722 YKL-40 is directly produced by tumor cells and is inversely linked to EGFR in glioblastomas.
20174854 YKL-40 overexpression is not associated with high-grade gliomas.
20099501 YKL-40 (chitinase 3-like 1) in newly diagnosed ovarian cancer patients was significantly higher than in patients with BRCA 1 gene mutation, women with benign epithelial cancer and patients with ovarian cancer at the time of complete remission
20056225 serum YKL-40 and hsCRP levels are independently associated with lesion progression in patients with coronary artery disease
20051317 the genetic variants in the CHI3L1 gene have ethnic heterogeneity and confer a susceptibility to schizophrenia in Asian populations.
20051317 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20047081 Results describe the associations between plasma IGF-I versus interleukin 6 (IL-6) and the acute phase proteins high sensitive C-reactive protein (hsCRP) and YKL-40 in a population-based study comprising 629 individuals, aged 50-89 years.
20012147 high plasma YKL-40 before ablation is associated with recurrence of atrial fibrillation
19961288 Elevated YKL-40 levels in congestive heart failure patients are explained by the presence of concomitant diseases.
19767768 blockade of YKL-40 using small-interfering RNA gene knockdown suppressed tumor angiogenesis in vitro and in vivo.
19765801 overexpression of YKL-40 is correlated with the aggressive behavior of tumor cells
19701838 YKL-40 is related to severity of peritoneal endometriosis.
19694834 YKL-40 expression in anal carcinoma predicts shorter overall and disease-free survival.
19666003 These results suggest that macrophage/preadipocyte interaction enhances degradation of type I collagen in AT, meanwhile, YKL-40 secreted from macrophages infiltrating into adipose tissue inhibits the type I collagen degradation.
19644363 asthma susceptibility genes; review of genetic and fuctional studies
19568425 in contrast to previous studies, the rs4950928 G allele, and not the C allele, was found to be associated with asthma; a few other SNPs of the CHI3L1 were found to be significantly associated with atopy and FEV1/FVC ratio, respectively
19550125 YKL-40 may be used as a new molecular marker to predict the prognosis of epithelial ovarian cancer.
19536175 Observational study of gene-disease association. (HuGE Navigator)
19421404 Single nucleotide polymorphisms in CHI3L1 is not associated with type 2 diabetes and related quantitative traits.
19421404 Observational study of gene-disease association. (HuGE Navigator)
19308408 Higher concentrations of YKL-40 indicate the level of cartilage destruction and can be used for assessment of destruction in knee osteoarthritis.
19264973 Observational study of gene-disease association. (HuGE Navigator)
19255724 No association of (-131C-->G) variant of CHI3L1 gene was found with glioblastoma.
19255724 Observational study of gene-disease association. (HuGE Navigator)
19200605 higher serum YKL-40 levels were observed in patients with more severe proteinuria (>or=3+ by dipstick) than in patients with milder proteinuria
19197227 A positive correlation between sYKL-40 and blood IL-6 level on ICU admission was noted in the sepsis group (r = 0.465, P < 0.01). YKL-40 identified by proteomic analysis is considered as a biomarker of sepsis.
19106306 The g.-247C/T polymorphism in the CHI3L1 promoter region is associated with the risk of atopy
19106306 Observational study of gene-disease association. (HuGE Navigator)
19089918 Elevated levels of CHI3L1 mRNA, encoding the secreted glycoprotein YKL-40, are associated with poor survival in glioblastoma.
19070929 a functional role of YKL-40 in liver fibrogenesis and should be taken into account when using YKL-40 as a non-invasive fibrosis marker.
19070929 Observational study of gene-disease association. (HuGE Navigator)
19003601 review of CHI3L1 and it's activity in cancer and other diseases [review]
18957531 Role of YKL-40 as a marker of inflammation in the gradually progressing vascular complications in patients with type 1 diabetes.
18802121 Elevated levels of chitinase-like protein YKL-40 are found in serum and bronchoalveolar lavage fluid, and greater numbers of YKL-40-expressing cells in bronchial biopsies, of smokers with chronic obstructive pulmonary disease.
18767121 the genetic contribution of CHI3L1 to schizophrenia is variable, even though it is mechanistically involved in the disease process.
18767121 Observational study of gene-disease association. (HuGE Navigator)
18723551 Pretreatment serum YKL-40 level is a possible prognosticator of cervical adenocarcinoma.
18708058 TNF-alpha suppresses YKL-40 expression in glioma cell lines in a NF-kappaB dependent manner.
18650368 Plasma YKL-40 was identified as an obesity-independent marker of type 2 diabetes
18615353 Plasma YKL-40 was significantly increased in patients with STEMI and stable CAD
18570155 YKL-40 protein expression was redistributed in carcinoma versus normal glandular tissue of the breast.
18490894 involved in the enhancement of chitin binding protein-expressing bacterial adhesion to colonic epithelial cells
18480670 serum concentrations of YKL-40 (chitinase 3-like 1) are greatly increased in AMI patients with and without thrombolytic therapy
18403759 CHI3L1 is a susceptibility gene for asthma, bronchial hyperresponsiveness, and reduced lung function, and elevated circulating YKL-40 levels are a biomarker for asthma and decline in lung function.
18403759 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18281018 We identified significant association with the same risk allele at the promoter single nucleotide polymorphism (SNP) associated in the original study (rs10399805; p = .018) and with another SNP at intron 7 of CHI3L1 (rs2275351; p = .008).
18281018 Observational study of gene-disease association. (HuGE Navigator)
18280741 We show that elevated YKL-40 levels are not correlated with the severity of subarachnoid haemorrhage and cannot be used as a serological marker of inflammation in patients with an aneurysm rupture.
18217402 YKL-40 does not seem to have a role in liver fibrosis in children with chronic hepatitis B
18190830 High serum YKL-40 levels in patients with primary prostate cancer indicate that YKL-40 may have a function in the progression of malignant diseases.
18182077 potential role for YKL-40 in myeloma-related bone disease must be considered
18157633 YKL-40 protein may not have a role in progression of primary breast cancer
18092325 High levels of CHI3L1 is associated with glioblastoma
18054022 concentration in cord serum significantly higher in pre-eclamptic pregnancies but no significant difference in maternal serum levels between the case and control groups
17957792 High serum levels of YKL-40 is associated with squamous cell carcinoma of the head and neck
17712177 YKL-40 is associated with cell proliferation, differentiation, and tissue morphogenesis during development of the human musculoskeletal system
17631744 YKL-40 release by intervertebral disc culture may better clarify its role in the pathophysiology of discal degeneration and inflammation and its relationships with COX-2 and NO in disc tissue culture.
17599744 A candidate autoantigen in rheumatoid arthritis found in synovial fluid cells.
17565739 Data suggest that measuring YKL-40 in nipple aspirate fluid may improve the identification of women at increased breast cancer risk.
17545529 YKL-40 has a role in success of hormonal treatment for metastatic prostate cancer
17543889 conformational comparison of MGP40 and HUMGP39
17236752 Observational study of gene-disease association. (HuGE Navigator)
17236752 YKL-40 may be used as a sarcoidosis disease marker, but it is unsuitable as a marker to predict the course of the disease.
17160890 Observational study of gene-disease association. (HuGE Navigator)
17160890 CHI3L1 as a potential schizophrenia-susceptibility gene and suggest that the genes involved in the biological response to adverse environmental conditions are likely to play roles in the predisposition to schizophrenia.
17020973 High YKL40 is associated with high-grade gliomas
16960935 Once-weekly intranasal treatment with Org39141 was well tolerated, and no serious or severe AE were reported.
16955240 This article reviews the studies of YKL-40 with focus on a possible role of YKL-40 in insulin resistance, endothelial dysfunction and atherosclerosis.
16818690 The YKL-40 expression was associated with the expressions of p-MAPK, p-mTOR, and p-p70S6K (all P < 0.02), with a trend toward association with p-Akt expression (P = 0.095).
16234240 induction and continued secretion of CHI3L1 in chondrocytes require sustained activation of NF-kappaB
15867231 Findings implicate YKL-40 as an important marker of therapeutic response and genetic subtype in glioblastomas and suggest that it may play an oncogenic role in these tumors.
15829322 YKL-40 may have role in neoplasm invasiveness; protein could stimulate fibroblast proliferation, promote angiogenesis, and protect cancer and/or stromal cells against apoptosis
15788675 Down-regulation of YKL-40 is associated with gliomas
15569925 the presence of HC gp-39-specific immune responses in healthy individuals may have an inhibitory effect on inflammatory responses in areas where HC gp-39 is present, and the response in rheumatoid arthritis has shifted toward a proinflammatory phenotype
14555515 High levels of serum YKL-40 reflect aggressiveness of metastatic breast cancer
12957359 upregulgated in glioblstoma multiforme.
12933821 results indicated a predominant role for a single Sp1 binding site in regulating human cartilage-gp39 promoter activity in macrophages
12851408 chitin or a closely related oligosaccharide could act as the physiological ligand for HCgp-39.
12799184 CHI3L1 has profound effects on vascular smooth muscle cell (VSMC) migration but no effect on fibroblast migration. In addition, CHI3L1 adsorbed to polystyrene surfaces directly promotes VSMC attachment and spreading.
12759455 HC-GP39 complexed with HLA-DR alpha beta 1*0401 is localized and presented on dendritic cells in the synovial tissue of rheumatoid arthritis patients.
12435396 human chitinase 3-like 2 gene (YKL-39) but not chitinase 3-like 1 gene (YKL-40) is upregulated in osteoarthritic cartilage
12071845 The chitinase 3-like protein human cartilage glycoprotein 39 (HC-gp39) stimulates proliferation of human connective-tissue cells and activates both extracellular signal-regulated kinase- and protein kinase B-mediated signalling pathways.
12069012 elevated serum levels in patients with Streptococcus pneumoniae bacteremia and associated with the outcome of the disease
11986266 YKL-40 is elevated in cerebrospinal fluid from patients with purulent meningitis

AA Sequence

MGVKASQTGFVVLVLLQCCSAYKLVCYYTSWSQYREGDGSCFPDALDRFLCTHIIYSFANISNDHIDTWE      1 - 70
WNDVTLYGMLNTLKNRNPNLKTLLSVGGWNFGSQRFSKIASNTQSRRTFIKSVPPFLRTHGFDGLDLAWL     71 - 140
YPGRRDKQHFTTLIKEMKAEFIKEAQPGKKQLLLSAALSAGKVTIDSSYDIAKISQHLDFISIMTYDFHG    141 - 210
AWRGTTGHHSPLFRGQEDASPDRFSNTDYAVGYMLRLGAPASKLVMGIPTFGRSFTLASSETGVGAPISG    211 - 280
PGIPGRFTKEAGTLAYYEICDFLRGATVHRILGQQVPYATKGNQWVGYDDQESVKSKVQYLKDRQLAGAM    281 - 350
VWALDLDDFQGSFCGQDLRFPLTNAIKDALAAT                                         351 - 383
//

Text Mined References (290)

PMID Year Title
27152377 2016 Diagnostic Value of Serum YKL-40 Level for Coronary Artery Disease: A Meta-Analysis.
27121858 2016 High CHI3L1 expression is associated with glioma patient survival.
27069189 2016 Testing of a Novel Cancer Metastatic Multiplex Panel for the Detection of Bone-metastatic Disease - a Pilot Study.
27013031 2016 YKL-40 expression in chronic obstructive pulmonary disease: relation to acute exacerbations and airway remodeling.
26828595 2016 Elevated Serum Concentration of Chitinase 3-Like 1 is an Independent Prognostic Biomarker for Poor Survival in Lung Cancer Patients.
26733160 2016 Role of chitinase-like proteins in cancer.
26698298 2015 Neurogranin and YKL-40: independent markers of synaptic degeneration and neuroinflammation in Alzheimer's disease.
26696093 2015 Regulation of YKL-40 expression by corticosteroids: effect on pro-inflammatory macrophages in vitro and its modulation in COPD in vivo.
26620310 2015 Expression of YKL-40 and MIP-1a proteins in exudates and transudates: biomarkers for differential diagnosis of pleural effusions? A pilot study.
26603717 2016 Serum YKL-40 in young patients with ?-thalassemia major: Relation to hepatitis C virus infection, liver stiffness by transient elastography and cardiovascular complications.
26523896 2015 YKL-40: may be use as a new inflammatory biomarker in obstructive sleep apnea syndrome?
26466985 2016 CHI3L1 nuclear localization in monocyte derived dendritic cells.
26452028 2015 Overexpression of CHI3L1 is associated with chemoresistance and poor outcome of epithelial ovarian carcinoma.
26427144 2015 Increased Synovial Fluid YKL-40 Levels are Linked with Symptomatic Severity in Knee Osteoarthritis Patients.
26415140 2015 CHI3L1 Is a Liver-Enriched, Noninvasive Biomarker That Can Be Used to Stage and Diagnose Substantial Hepatic Fibrosis.
26382922 2015 Relationship of YKL-40 and adiponectin and subclinical atherosclerosis in asymptomatic patients with type 1 diabetes mellitus from a European Mediterranean population.
26372680 2016 Increased YKL-40 and Chitotriosidase in Asthma and Chronic Obstructive Pulmonary Disease.
26316585 2016 The impact of acute aerobic exercise on chitinase 3-like protein 1 and intelectin-1 expression in obesity.
26310833 2015 YKL-40/CHI3L1 drives inflammation on the road of tumor progression.
26301577 2015 Plasma YKL-40 during pregnancy and gestational diabetes mellitus.
26295543 2016 SSEA-4 and YKL-40 positive progenitor subtypes in the subventricular zone of developing human neocortex.
26275425 2015 YKL-40 regulated epithelial-mesenchymal transition and migration/invasion enhancement in non-small cell lung cancer.
26270969 2015 The Inflammatory Marker YKL-40 Is Elevated in Cerebrospinal Fluid from Patients with Alzheimer's but Not Parkinson's Disease or Dementia with Lewy Bodies.
26197239 2015 Associations of the Inflammatory Marker YKL-40 with Measures of Obesity and Dyslipidaemia in Individuals at High Risk of Type 2 Diabetes.
26142786 2015 Serum YKL-40/chitinase 3-like protein 1 level is an independent predictor of atherosclerosis development in patients with obstructive sleep apnea syndrome.
26125767 2015 Disease indicators for sepsis and analysis of sepsis treatment in children using the continuous blood purification technique.
26121745 2015 Chitinase 3-like-1 and its receptors in Hermansky-Pudlak syndrome-associated lung disease.
26095694 2015 Observational and genetic plasma YKL-40 and cancer in 96,099 individuals from the general population.
26002577 2015 Serum markers in early-stage and locally advanced melanoma.
25976273 2015 The Role of MicroRNA, miR-24, and Its Target CHI3L1 in Osteomyelitis Caused by Staphylococcus aureus.
25941933 2015 Quantitative Real-Time PCR Analysis of YKL-40 and Its Comparison with Mammalian Chitinase mRNAs in Normal Human Tissues Using a Single Standard DNA.
25909875 2015 Prognostic significance of the markers IDH1 and YKL40 related to the subventricular zone.
25875173 2015 YKL-40/c-Met expression in rectal cancer biopsies predicts tumor regression following neoadjuvant chemoradiotherapy: a multi-institutional study.
25760838 2015 [Association between CHI3L1 SNPs and susceptibility to childhood asthma].
25698171 2015 Chitinase 3-like proteins as diagnostic and prognostic biomarkers of multiple sclerosis.
25688078 2015 Chitinase 3-like 1: prognostic biomarker in clinically isolated syndromes.
25657159 2015 The association between serum YKL-40 levels, mean platelet volume, and c-reactive protein in patients with cellulitis.
25629580 2015 Chitinase 3-like-1 regulates both visceral fat accumulation and asthma-like Th2 inflammation.
25629266 2014 Protein and mRNA levels of YKL-40 in high-grade glioma.
25624368 2015 Elevated plasma YKL-40, lipids and lipoproteins, and ischemic vascular disease in the general population.
25592985 2015 Genetic variation in chitinase 3-like 1 (CHI3L1) contributes to asthma severity and airway expression of YKL-40.
25573204 2015 Serum YKL-40: a new independent prognostic marker for skeletal complications in patients with multiple myeloma.
25545245 2014 Identification of neutrophil activation markers as novel surrogate markers of CF lung disease.
25519006 2015 Proteins from the 18 glycosyl hydrolase family are associated with kidney dysfunction in patients with diabetes type 2.
25497736 2015 Association between serum YKL-40 level and dysglycemia in cystic fibrosis.
25486056 2014 Circulating YKL-40 level, but not CHI3L1 gene variants, is associated with atherosclerosis-related quantitative traits and the risk of peripheral artery disease.
25421412 2015 Serum YKL-40: a potential biomarker for psoriasis or endothelial dysfunction in psoriasis?
25412935 2014 Diagnostic role of circulating YKL-40 in endometrial carcinoma patients: a meta-analysis of seven related studies.
25400457 2014 Increased expression and possible role of chitinase 3-like-1 in a colitis-associated carcinoma model.
25343670 2014 Serum YKL-40 for monitoring myocardial ischemia after revascularization in patients with stable coronary artery disease.
25304157 2015 Increased expression of chitinase 3-like 1 is a prognosis marker for non-small cell lung cancer correlated with tumor angiogenesis.
25270518 2014 Two sides of a coin: the dual roles of chitinase 3-like 1 in idiopathic pulmonary fibrosis.
25262987 2014 Serum YKL-40 levels as a prognostic factor in patients with intracerebral hemorrhage.
25225167 2014 YKL-40 and alcoholic liver and pancreas damage and disease in 86,258 individuals from the general population: cohort and mendelian randomization studies.
25203433 2014 Correlation of chitinase 3-like 1 single nucleotide polymorphisms and haplotypes with uterine cervical cancer in Taiwanese women.
25187353 2014 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
25172979 2014 C-reactive protein and chitinase 3-like protein 1 as biomarkers of spatial redistribution of retinal blood vessels on digital retinal photography in patients with diabetic retinopathy.
25172968 2014 Elevation in circulating YKL-40 concentration in patients with cerebrovascular disease.
25142236 2014 Increased expression of Chitinase 3-like 1 and microvessel density predicts metastasis and poor prognosis in clear cell renal cell carcinoma.
25139333 2014 Diagnostic and prognostic value of preoperative combined GFAP, IGFBP-2, and YKL-40 plasma levels in patients with glioblastoma.
25128003 2014 Urine YKL-40 is associated with progressive acute kidney injury or death in hospitalized patients.
25068525 2014 Maternal serum apelin and YKL-40 levels in early and late-onset pre-eclampsia.
25056157 2014 CHI3L1 polymorphisms associate with asthma in a Taiwanese population.
25051073 2014 Association of serum YKL-40 with the presence and severity of obstructive sleep apnea syndrome.
25047113 2014 Chitinase 3-like 1 is induced by Plasmodium falciparum malaria and predicts outcome of cerebral malaria and severe malarial anaemia in a case-control study of African children.
25024322 2014 Cerebrospinal fluid level of YKL-40 protein in preclinical and prodromal Alzheimer's disease.
25001061 2014 Establishment of using serum YKL-40 and SCCA in combination for the diagnosis of patients with esophageal squamous cell carcinoma.
24996799 2014 Elevated pretreatment serum concentration of YKL-40: an independent prognostic biomarker for poor survival in patients with colorectal cancer.
24981110 2014 Elevated YKL40 is associated with advanced prostate cancer (PCa) and positively regulates invasion and migration of PCa cells.
24958781 2014 Plasma levels of the proinflammatory chitin-binding glycoprotein YKL-40, variation in the chitinase 3-like 1 gene (CHI3L1), and incident cardiovascular events.
24954373 2014 The chitinase-like protein YKL-40 is not a useful biomarker for severe persistent asthma in children.
24920662 2014 Chitinase 3-like 1 suppresses injury and promotes fibroproliferative responses in Mammalian lung fibrosis.
24878721 2014 Increased plasma YKL-40/chitinase-3-like-protein-1 is associated with endothelial dysfunction in obstructive sleep apnea.
24861484 2014 Serum YKL-40 and uterine artery Doppler -- a prospective cohort study, with focus on preeclampsia and small-for-gestational-age.
24842123 2014 YKL-40 downregulation is a key factor to overcome temozolomide resistance in a glioblastoma cell line.
24814404 2014 Prognostic effect of serum and tissue YKL-40 levels in bladder cancer.
24808626 2014 Serum YKL-40 levels and chitotriosidase activity in patients with beta-thalassemia major.
24801872 2014 Serum YKL-40 level is associated with the chemotherapy response and prognosis of patients with small cell lung cancer.
24730590 2014 Antigen-specific over-expression of human cartilage glycoprotein 39 on CD4+ CD25+ forkhead box protein 3+ regulatory T cells in the generation of glucose-6-phosphate isomerase-induced arthritis.
24729664 2014 Increased expression of chitinase 3-like 1 in aorta of patients with atherosclerosis and suppression of atherosclerosis in apolipoprotein E-knockout mice by chitinase 3-like 1 gene silencing.
24691276 2014 Chitinase 3 like 1 is associated with tumor angiogenesis in cervical cancer.
24689875 2014 Circulating YKL-40 in myelofibrosis a potential novel biomarker of disease activity and the inflammatory state.
24685381 2014 Pretransplant serum human chitinase-like glycoprotein YKL-40 concentrations independently predict bronchiolitis obliterans development in lung transplant recipients.
24650028 2014 YKL-40 expression in soft-tissue sarcomas and atypical lipomatous tumors. An immunohistochemical study of 49 tumors.
24582001 2014 CSF levels of YKL-40 are increased in MS and replaces with immunosuppressive treatment.
24572981 2014 Chitotriosidase as a possible marker of clinically evidenced atherosclerosis in dyslipidemic children.
24512683 2014 Chitinase-3-like protein 1 protects skeletal muscle from TNF?-induced inflammation and insulin resistance.
24498368 2014 Plasma YKL-40 in patients with metastatic colorectal cancer treated with first line oxaliplatin-based regimen with or without cetuximab: RESULTS from the NORDIC VII Study.
24442412 2014 The significance of YKL-40 protein in liver fibrosis.
24440516 2014 Determination of chitinases family during osteoclastogenesis.
24405178 2014 Serum YKL-40 concentrations are elevated and correlated with disease severity in patients with obstructive sleep apnea syndrome.
24324091 2013 YKL-40 and mesothelin in the blood of patients with malignant mesothelioma, lung cancer and asbestosis.
24309227 2013 Association of serum YKL-40 levels with the presence and severity of coronary artery disease in patients with obstructive sleep apnea syndrome.
24256818 2013 Usefulness of plasma YKL-40 in management of community-acquired pneumonia severity in patients.
24062521 2013 Genetic variants in CHI3L1 influencing YKL-40 levels: resequencing 900 individuals and genotyping 9000 individuals from the general population.
23918300 2014 YKL-40 expression could be a poor prognostic marker in the breast cancer tissue.
23792508 2013 Correlation between serum YKL-40 (chitinase-3-like protein 1) level and proteinuria in renal transplant recipients.
23706599 2013 Plasma YKL-40 and CHI3L1 in systemic inflammation and sepsis-experience from two prospective cohorts.
23671604 2013 Expression of the chitinase family glycoprotein YKL-40 in undifferentiated, differentiated and trans-differentiated mesenchymal stem cells.
23665676 2014 Tumor-derived mural-like cells coordinate with endothelial cells: role of YKL-40 in mural cell-mediated angiogenesis.
23628340 2013 The chitinase-like protein YKL-40: a possible biomarker of inflammation and airway remodeling in severe pediatric asthma.
23613996 2013 Stat3 downstream gene product chitinase 3-like 1 is a potential biomarker of inflammation-induced lung cancer in multiple mouse lung tumor models and humans.
23591413 2013 Intake of traditional Inuit diet vary in parallel with inflammation as estimated from YKL-40 and hsCRP in Inuit and non-Inuit in Greenland.
23573226 2013 Overexpression of YKL-40 predicts plaque instability in carotid atherosclerosis with CagA-positive Helicobacter pylori infection.
23562456 2013 Diverse pathological implications of YKL-40: answers may lie in 'outside-in' signaling.
23551676 2013 Novel inflammatory marker in dialysis patients: YKL-40.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23525579 2013 The expression of chitinase 3-like 1: a novel prognostic predictor for hepatocellular carcinoma.
23501042 2013 Ghrelin-leptin network influences serum chitinase 3-like protein 1 (YKL-40) levels in obese prepubertal children.
23490418 2013 YKL-40 in hemodialyzed patients with and without cardiovascular complications - the enhancement by the coexistence of the seropositivity against hepatitis C virus infection.
23397672 2012 YKL-40 in induced sputum after allergen bronchial provocation in atopic asthma.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23364142 2013 High serum YKL-40 level in patients with COPD is related to hypoxemia and disease severity.
23294528 2013 Serum YKL-40 predicts long-term mortality in patients with stable coronary disease: a prognostic study within the CLARICOR trial.
23291472 2013 Chitinase-like protein Brp-39/YKL-40 modulates the renal response to ischemic injury and predicts delayed allograft function.
23279705 2013 A polymorphism associated with increased levels of YKL-40 and the risk of early onset of lone atrial fibrillation.
23272150 2012 Serum YKL-40 levels correlate with infarct volume, stroke severity, and functional outcome in acute ischemic stroke patients.
23227243 2012 High YKL-40 serum concentration is correlated with prognosis of Chinese patients with breast cancer.
23226395 2012 Hepatitis C virus mediated changes in miRNA-449a modulates inflammatory biomarker YKL40 through components of the NOTCH signaling pathway.
23197259 2013 YKL-40 induces IL-8 expression from bronchial epithelium via MAPK (JNK and ERK) and NF-?B pathways, causing bronchial smooth muscle proliferation and migration.
23190377 2013 Association of CHI3L1 in African-Americans with prior history of asthma exacerbations and stress.
23170831 2013 Potential association between TLR4 and chitinase 3-like 1 (CHI3L1/YKL-40) signaling on colonic epithelial cells in inflammatory bowel disease and colitis-associated cancer.
23149946 2013 Evaluation of CHI3L-1 and CHIT-1 expression in differentiated and polarized macrophages.
23071724 2012 The Association between genetic variations of CHI3L1, levels of the encoded glycoprotein YKL-40 and the lipid profile in a Danish population.
22989351 2013 YKL-40-gene polymorphism affects acute cellular rejection and fibrosis progression after transplantation for hepatitis C virus-induced liver disease.
22986489 2013 Association of serum YKL-40 levels with urinary albumin excretion rate in young Japanese patients with type 1 diabetes mellitus.
22955689 2013 Elevated serum YKL-40 level predicts myocardial reperfusion and in-hospital MACE in patients with STEMI.
22937056 2012 Variations of CHI3L1, levels of the encoded glycoprotein YKL-40 and prediction of fatal and non-fatal ischemic stroke.
22809439 2012 Potential association between coronary artery disease and the inflammatory biomarker YKL-40 in asymptomatic patients with type 2 diabetes mellitus.
22655594 2012 Extent of tumor removal and molecular markers in cerebral glioblastoma: a combined prognostic factors study in a surgical series of 105 patients.
22647735 2012 Increased levels of YKL-40 and interleukin 6 in patients with chronic pancreatitis and secondary diabetes.
22642467 2012 Association between human cartilage glycoprotein 39 (YKL-40) and arterial stiffness in essential hypertension.
22628227 2012 Significant association of elevated concentration of plasma YKL-40 with disease severity in patients with pelvic inflammatory disease.
22583189 2012 Elevated circulating levels of YKL-40 are a marker of abnormal glucose tolerance in women with polycystic ovary syndrome.
22572101 2012 YKL-40 is elevated in patients with peripheral arterial disease and diabetes or pre-diabetes.
22554524 2012 Involvement of the MAPK and PI3K pathways in chitinase 3-like 1-regulated hyperoxia-induced airway epithelial cell death.
22534532 2012 Promoter polymorphisms in CHI3L1 are associated with asthma.
22525348 2013 YKL-40 levels and atrial fibrillation in the general population.
22480951 2012 Levels of YKL-40 in pleural effusions and blood from patients with pulmonary or pleural disease.
22433444 2012 Chitinase 3-like 1 gene-329G/A polymorphism, plasma concentration and risk of coronary heart disease in a Chinese population.
22366530 2012 A promoter variant in the chitinase 3-like 1 gene is associated with serum YKL-40 level and personality trait.
22351690 2012 Proximal fluid proteome profiling of mouse colon tumors reveals biomarkers for early diagnosis of human colorectal cancer.
22281830 2012 Role of YKL-40 in bronchial smooth muscle remodeling in asthma.
22211103 2012 Two closely related human members of chitinase-like family, CHI3L1 and CHI3L2, activate ERK1/2 in 293 and U373 cells but have the different influence on cell proliferation.
22209156 2012 The inflammatory biomarker YKL-40 as a new prognostic marker for all-cause mortality in patients with heart failure.
22209020 2012 High YKL-40 levels predict mortality in patients with type 2 diabetes.
22183936 2012 Chitinase 3-like 1 plasma levels are increased in patients with progressive forms of multiple sclerosis.
22146624 2011 YKL-40 expression in human hepatocellular carcinoma: a potential biomarker?
22140133 2012 YKL-40 is differentially expressed in human embryonic stem cells and in cell progeny of the three germ layers.
22103814 2012 YKL-40 genetic polymorphisms and the risk of liver disease progression in patients with advanced fibrosis due to chronic hepatitis C.
22095223 2012 Cancer risk by combined levels of YKL-40 and C-reactive protein in the general population.
22074331 2012 Astrocyte and macrophage regulation of YKL-40 expression and cellular response in neuroinflammation.
22056877 2012 Chitinase 3-like 1 promotes macrophage recruitment and angiogenesis in colorectal cancer.
22036069 2012 Elevated circulating levels of the serum acute-phase protein YKL-40 (chitinase 3-like protein 1) are a marker of obesity and insulin resistance in prepubertal children.
21978279 2012 Expression of pERK and pAKT in pediatric high grade astrocytomas: correlation with YKL40 and prognostic significance.
21968467 2012 Sputum YKL-40 levels and pathophysiology of asthma and chronic obstructive pulmonary disease.
21953450 2011 A complex of nuclear factor I-X3 and STAT3 regulates astrocyte and glioma migration through the secreted glycoprotein YKL-40.
21949714 2011 The chitinase-like protein YKL-40 modulates cystic fibrosis lung disease.
21934681 2011 Breast cancer expression of YKL-40 correlates with tumour grade, poor differentiation, and other cancer markers.
21858537 2011 Evaluation of multiple serum markers in advanced melanoma.
21831900 2011 Serum YKL-40 is a marker of prognosis and disease status in high-grade gliomas.
21820815 2011 Increased tissue immunoexpression of YKL-40 protein in high grade serous ovarian cancers.
21782391 2011 YKL-40 (chitinase 3-like-1) as a biomarker for psoriasis vulgaris and pustular psoriasis.
21715039 2011 The interplay of YKL-40 and leptin in type 2 diabetic obese patients.
21714862 2011 Promoter polymorphisms in the chitinase 3-like 1 gene influence the serum concentration of YKL-40 in Danish patients with rheumatoid arthritis and in healthy subjects.
21642896 2011 Allelic expression imbalance of the schizophrenia susceptibility gene CHI3L1: evidence of cis-acting variation and tissue specific regulation.
21530869 2011 The CHI3L1 rs4950928 polymorphism is associated with asthma-related hospital admissions in children and young adults.
21496058 2011 Increased serum YKL-40: a new potential marker for airway allergic responses in adult patients with food allergy.
21478032 2011 IL-6, but not TNF-?, increases plasma YKL-40 in human subjects.
21391238 2011 YKL-40 and MMP-9 as serum markers for patients with primary central nervous system lymphoma.
21385870 2011 Role of YKL-40 in the angiogenesis, radioresistance, and progression of glioblastoma.
21272568 2011 Plasma YKL-40 levels in healthy subjects from the general population.
21258804 2012 The effect of mud pack therapy on serum YKL-40 and hsCRP levels in patients with knee osteoarthritis.
21257319 2011 Genetic polymorphisms in chitinase 3-like 1 (CHI3L1) are associated with circulating YKL-40 levels, but not with angiographic coronary artery disease in a Chinese population.
21159721 2011 Chitinase effects on immune cell response in neuromyelitis optica and multiple sclerosis.
21159401 2011 YKL-40, a new biomarker of endothelial dysfunction, is independently associated with albuminuria in type 2 diabetic patients.
21143859 2010 Increased levels of the calcification marker matrix Gla Protein and the inflammatory markers YKL-40 and CRP in patients with type 2 diabetes and ischemic heart disease.
21029458 2010 Resveratrol represses YKL-40 expression in human glioma U87 cells.
20972697 2011 The influence of statin treatment on the inflammatory biomarkers YKL-40 and HsCRP in patients with stable coronary artery disease.
20961744 2011 Up-regulation of the novel proinflammatory adipokines lipocalin-2, chitinase-3 like-1 and osteopontin as well as angiogenic-related factors in visceral adipose tissue of patients with colon cancer.
20943784 2011 Increased circulating and visceral adipose tissue expression levels of YKL-40 in obesity-associated type 2 diabetes are related to inflammation: impact of conventional weight loss and gastric bypass.
20926018 YKL-40 protein levels and clinical outcome of human endometrial cancer.
20840668 2010 YKL-40 and mast cells are associated with detrusor fibrosis in patients diagnosed with bladder pain syndrome/interstitial cystitis according to the 2008 criteria of the European Society for the Study of Interstitial Cystitis.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20674561 2010 A promoter polymorphism -2122C>T of CHI3L1 is associated with serum low density lipoprotein cholesterol level in Korean subjects.
20656949 2011 Role of breast regression protein-39 in the pathogenesis of cigarette smoke-induced inflammation and emphysema.
20650887 2010 The chitinase-like protein YKL-40 is secreted by airway epithelial cells at base line and in response to compressive mechanical stress.
20640910 2010 Circulating levels of interleukin-6, vascular endothelial growth factor, YKL-40, matrix metalloproteinase-3, and total aggrecan in spondyloarthritis patients during 3 years of treatment with TNF? inhibitors.
20558631 2010 The chitinase-like proteins breast regression protein-39 and YKL-40 regulate hyperoxia-induced acute lung injury.
20540736 2010 In vivo CHI3L1 (YKL-40) expression in astrocytes in acute and chronic neurological diseases.
20538957 2010 Fungal exposure modulates the effect of polymorphisms of chitinases on emergency department visits and hospitalizations.
20506295 2011 CHI3L1 (YKL-40) is expressed in human gliomas and regulates the invasion, growth and survival of glioma cells.
20499402 2010 Association between YKL-40 and adult primary astrocytoma.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
20356987 2010 YKL-40 in asthmatic patients, and its correlations with exacerbation, eosinophils and immunoglobulin E.
20347092 2010 Increased YKL-40 expression in patients with carotid atherosclerosis.
20300754 2011 Lack of evidence for association of two functional SNPs of CHI3L1 gene (HC-gp39) with rheumatoid arthritis.
20237129 2010 Cerebrospinal fluid chitinase 3-like 1 levels are associated with conversion to multiple sclerosis.
20226308 2010 Polymorphisms of chitinases are not associated with asthma.
20224722 2010 YKL-40 is directly produced by tumor cells and is inversely linked to EGFR in glioblastomas.
20174854 2010 Prognostic significance of histological grading, p53 status, YKL-40 expression, and IDH1 mutations in pediatric high-grade gliomas.
20099501 2009 Serum YKL-40 levels in patients with ovarian cancer and women with BRCA1 gene mutation--comparison to CA 125 antigen.
20056225 2010 Increased serum YKL-40 and C-reactive protein levels are associated with angiographic lesion progression in patients with coronary artery disease.
20051317 2010 The chitinase 3-like 1 gene and schizophrenia: evidence from a multi-center case-control study and meta-analysis.
20047081 2010 Associations between plasma insulin-like growth factor-I and the markers of inflammation interleukin 6, C-reactive protein and YKL-40 in an elderly background population.
20012147 2010 Plasma YKL-40 is elevated in patients with recurrent atrial fibrillation after catheter ablation.
19961288 2010 Plasma YKL-40 levels are elevated in patients with chronic heart failure.
19767768 2009 YKL-40, a secreted glycoprotein, promotes tumor angiogenesis.
19765801 2009 Overexpression of YKL-40 is an independent prognostic marker in gastric cancer.
19701838 2010 Immunohistochemical expression of YKL-40 in peritoneal endometriosis.
19694834 2009 YKL-40 expression in anal carcinoma predicts shorter overall and disease-free survival.
19666003 2009 YKL-40 secreted from adipose tissue inhibits degradation of type I collagen.
19644363 2009 The chitinase and chitinase-like proteins: a review of genetic and functional studies in asthma and immune-mediated diseases.
19568425 2009 Association of polymorphisms of the CHI3L1 gene with asthma and atopy: a populations-based study of 6514 Danish adults.
19550125 2009 Expression and clinical significance of YKL-40 protein in epithelial ovarian cancer tissues.
19536175 2009 Follow-up of a major linkage peak on chromosome 1 reveals suggestive QTLs associated with essential hypertension: GenNet study.
19421404 2009 Variation in CHI3LI in relation to type 2 diabetes and related quantitative traits.
19414556 2009 Role of breast regression protein 39 (BRP-39)/chitinase 3-like-1 in Th2 and IL-13-induced tissue responses and apoptosis.
19308408 2009 Human cartilage glycoprotein 39--biomarker of joint damage in knee osteoarthritis.
19264973 2009 Assessing the reproducibility of asthma candidate gene associations, using genome-wide data.
19255724 2009 No association of (-131C-->G) variant of CHI3L1 gene with risk of glioblastoma and prognosis.
19200605 2009 Serum levels of YKL-40 and interleukin-18 and their relationship to disease severity in patients with preeclampsia.
19197227 2009 YKL-40 identified by proteomic analysis as a biomarker of sepsis.
19106306 2009 Genetic variation in the promoter region of chitinase 3-like 1 is associated with atopy.
19089918 2009 Serum YKL-40 and bone marrow angiogenesis in multiple myeloma.
19070929 2009 A functional variation in CHI3L1 is associated with severity of liver fibrosis and YKL-40 serum levels in chronic hepatitis C infection.
19003601 2008 Chitinase 3-Like-1 (CHI3L1): a putative disease marker at the interface of proteomics and glycomics.
18957531 2009 YKL-40, a marker of inflammation and endothelial dysfunction, is elevated in patients with type 1 diabetes and increases with levels of albuminuria.
18802121 2008 YKL-40 is elevated in patients with chronic obstructive pulmonary disease and activates alveolar macrophages.
18767121 2009 Failure to confirm genetic association of the CHI3L1 gene with schizophrenia in Japanese and Chinese populations.
18723551 2009 Serum YKL-40 as a marker for cervical adenocarcinoma.
18708058 2008 Selective repression of YKL-40 by NF-kappaB in glioma cell lines involves recruitment of histone deacetylase-1 and -2.
18650368 2008 Plasma YKL-40: a BMI-independent marker of type 2 diabetes.
18615353 2008 YKL-40 a new biomarker in patients with acute coronary syndrome or stable coronary artery disease.
18570155 Subcellular localization of YKL-40 in normal and malignant epithelial cells of the breast.
18490894 2008 Chitinase 3-like-1 enhances bacterial adhesion to colonic epithelial cells through the interaction with bacterial chitin-binding protein.
18480670 2008 Serum levels of YKL-40 increases in patients with acute myocardial infarction.
18403759 2008 Effect of variation in CHI3L1 on serum YKL-40 level, risk of asthma, and lung function.
18281018 2008 Chitinase-3-like 1 (CHI3L1) gene and schizophrenia: genetic association and a potential functional mechanism.
18280741 2008 Elevated cerebrospinal fluid and serum YKL-40 levels are not associated with symptomatic vasospasm in patients with aneurysmal subarachnoid haemorrhage.
18217402 2007 Serum level of YKL-40 does not predict advanced liver fibrosis in children with chronic hepatitis B.
18190830 Serum YKL-40 levels and chitotriosidase activity as potential biomarkers in primary prostate cancer and benign prostatic hyperplasia.
18182077 2008 High serum YKL-40 concentration is associated with severe bone disease in newly diagnosed multiple myeloma patients.
18157633 2008 YKL-40 protein expression is not a prognostic marker in patients with primary breast cancer.
18092325 2008 Experimental anti-angiogenesis causes upregulation of genes associated with poor survival in glioblastoma.
18054022 2008 Chitotriosidase and YKL-40 in normal and pre-eclamptic pregnancies.
17957792 2008 High serum levels of YKL-40 in patients with squamous cell carcinoma of the head and neck are associated with short survival.
17712177 2007 YKL-40 protein expression in the early developing human musculoskeletal system.
17631744 YKL-40 in human lumbar herniated disc and its relationships with nitric oxide and cyclooxygenase-2.
17599744 2007 Endogenous HLA-DR-restricted presentation of the cartilage antigens human cartilage gp-39 and melanoma inhibitory activity in the inflamed rheumatoid joint.
17565739 2007 Increased expression of the inflammatory protein YKL-40 in precancers of the breast.
17545529 2007 Changes of biochemical markers of bone turnover and YKL-40 following hormonal treatment for metastatic prostate cancer are related to survival.
17543889 2007 Family 18 chitolectins: comparison of MGP40 and HUMGP39.
17236752 2007 A CHI3L1 gene polymorphism is associated with serum levels of YKL-40, a novel sarcoidosis marker.
17160890 2007 Functional variants in the promoter region of Chitinase 3-like 1 (CHI3L1) and susceptibility to schizophrenia.
17020973 2006 YKL-40 and matrix metalloproteinase-9 as potential serum biomarkers for patients with high-grade gliomas.
16960935 2006 Intranasal administration of recombinant human cartilage glycoprotein-39. A phase I escalating cohort study in patients with rheumatoid arthritis.
16955240 2006 YKL-40, a new inflammatory marker with relation to insulin resistance and with a role in endothelial dysfunction and atherosclerosis.
16818690 2006 Prognostic associations of activated mitogen-activated protein kinase and Akt pathways in glioblastoma.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16472595 2006 Chitinase 3-like-1 exacerbates intestinal inflammation by enhancing bacterial adhesion and invasion in colonic epithelial cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16234240 2005 Inflammatory cytokines induce production of CHI3L1 by articular chondrocytes.
15867231 2005 YKL-40 expression is associated with poorer response to radiation and shorter overall survival in glioblastoma.
15829322 2005 Expression of YKL-40 by peritumoral macrophages in human small cell lung cancer.
15788675 2005 YKL-40 is a differential diagnostic marker for histologic subtypes of high-grade gliomas.
15569925 2004 Functional regulatory immune responses against human cartilage glycoprotein-39 in health vs. proinflammatory responses in rheumatoid arthritis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14555515 2003 High levels of serum HER-2/neu and YKL-40 independently reflect aggressiveness of metastatic breast cancer.
12957359 2003 HC gp-39 gene is upregulated in glioblastomas.
12933821 2003 Transcriptional regulation of CHI3L1, a marker gene for late stages of macrophage differentiation.
12851408 2003 Crystal structure and carbohydrate-binding properties of the human cartilage glycoprotein-39.
12799184 2003 gp38k (CHI3L1) is a novel adhesion and migration factor for vascular cells.
12775711 2003 Structure and ligand-induced conformational change of the 39-kDa glycoprotein from human articular chondrocytes.
12759455 2003 Localization of MHC class II/human cartilage glycoprotein-39 complexes in synovia of rheumatoid arthritis patients using complex-specific monoclonal antibodies.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12435396 2002 Enhanced expression of the human chitinase 3-like 2 gene (YKL-39) but not chitinase 3-like 1 gene (YKL-40) in osteoarthritic cartilage.
12124825 2002 High serum YKL-40 level after surgery for colorectal carcinoma is related to short survival.
12069012 2002 Serum level of YKL-40 is elevated in patients with Streptococcus pneumoniae bacteremia and is associated with the outcome of the disease.
11986266 2002 YKL-40 is elevated in cerebrospinal fluid from patients with purulent meningitis.
10772238 2000 Human cartilage glycoprotein 39 (HC gp-39) mRNA expression in adult and fetal chondrocytes, osteoblasts and osteocytes by in-situ hybridization.
10515841 1999 YKL-40, a matrix protein of specific granules in neutrophils, is elevated in serum of patients with community-acquired pneumonia requiring hospitalization.
10461474 1999 Serum YKL-40 concentrations in patients with rheumatoid arthritis: relation to disease activity.
9492324 1998 Chitotriosidase, a chitinase, and the 39-kDa human cartilage glycoprotein, a chitin-binding lectin, are homologues of family 18 glycosyl hydrolases secreted by human macrophages.
9417865 1997 Induction and expression of human cartilage glycoprotein 39 in rheumatoid inflammatory and peripheral blood monocyte-derived macrophages.
9244440 1997 Molecular characterization of the gene for human cartilage gp-39 (CHI3L1), a member of the chitinase protein family and marker for late stages of macrophage differentiation.
8245017 1993 Human cartilage gp-39, a major secretory product of articular chondrocytes and synovial cells, is a mammalian member of a chitinase protein family.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
2375755 1990 Human synovial cells secrete a 39 kDa protein similar to a bovine mammary protein expressed during the non-lactating period.