Property Summary

NCBI Gene PubMed Count 77
PubMed Score 103.60
PubTator Score 116.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma -2.800 5.6e-08
osteosarcoma -1.537 9.1e-04
glioblastoma 1.100 3.3e-03
Pick disease -1.700 2.0e-06
progressive supranuclear palsy -1.400 7.4e-03
ovarian cancer 2.400 1.1e-06

 GO Component (2)

Gene RIF (68)

PMID Text
26542416 Data show that hypermethylation of the CHFR promoter, frequent in acute myeloid leukemia, is associated with adverse outcome, and can thus be used for risk stratification.
26356822 Small molecule inhibition of CHFR-PARP1 interaction is a novel potential therapeutic approach to increase the efficacy of taxane-based chemotherapy in cancer.
25828518 CHFR methylation has a role in methylation of DNA damage repair and apoptotic pathway genes in non-small cell lung cancer
25798877 Aberrant methylation of CHFR may be associated with the pathogenesis, progression for B-cell non-Hodgkin lymphoma(B-NHL), which might be a novel molecular marker as prognosis and treatment for B-NHL.
25304615 CHFR-PAX5 fusion transcript is associated with B-cell precursor acute lymphoblastic leukemia.
24928946 CHFR promoter methylation is associated with colorectal cancer.
24748501 CHFR unmethylation is associated with oxaliplatin resistance in gastric cancer.
24639283 CHFR methylation may have a role in chemosensitivity of paclitaxel in advanced gastric cancer
24375389 Studies indicate that checkpoint with forkhead and ring finger domains (CHFR) promoter CpG island methylation as prognostic marker.
24012691 CHFR ubiquitinates and regulates TOPK levels, which is essential for its checkpoint function.
23873170 CHFR methylation in CRC cell lines predicted for sensitivity in vitro and in vivo to docetaxel, while MSI-H cell lines were more sensitive to gemcitabine
23454125 a new regulatory mechanism for CHFR that sequential post-translational modifications of CHFR by SUMO and ubiquitin coordinately regulates its stability
23415374 CHFR aberrant methylation involves a subset of human lung adenocarcinoma associated with poor clinical outcomes.
23386692 CHFR expression is a novel predictive marker of response and overall survival in NSCLC patients treated with taxane-containing chemotherapy
23241409 Aggregated LDL prolongs the half life of LRP1 by preventing the receptor ubiquitinylation, at least in part, through CHFR targeting.
23131550 this study underscores the importance of CHFR SUMOylation as a new regulatory mechanism of CHFR and highlights the emerging role of SUMOylation in modulating protein stability.
22469813 suppression of CHFR induced a significant increase of the mitotic index and much lower numbers of cells at the G2/M phase in both cells treated with taxol, indicating mitotic checkpoint impairment
22337872 The interaction between CHFR and PARP-1 plays an important role in cell cycle regulation and cancer therapeutic strategies.
22159584 CHFR is thought to contribute towards regulating mitotic entry and possible explanations for contradictory observations published on the functions and regulation of CHFR are presented. [review]
22070084 CHFR is epigenetically inactivated by promoter methylation in nasopharyngeal carcinoma.
21768102 auto-ubiquitylation of E3 ubiquitin-protein ligase Chfr at G2 phase is required for accumulation of polo-like kinase 1 and mitotic entry in mammalian cell
21575600 These data support a critical role for CHFR in the MAD2 spindle checkpoint.
21551253 The extent of CHFR promoter methylation correlates with RFS, indicating it is a promising epigenetic marker for recurrence.
21409489 Hypermethylation of CHFR gene is associated with advanced gastric cancer.
21302620 CHFR methylation in cancer tissues was significantly associated with the extent of differentiation and lymph node metastasis of gastric cancer.
20942233 Hypermethylation of CHFR gene promoter is associated with loss or lower expression of CHFR mRNA in laryngeal squamous cell carcinoma.
20880844 The PBZ motif of CHFR recognizes two adenine-containing subunits of PAR and the phosphate backbone that connects them
20734064 Observational study of gene-disease association. (HuGE Navigator)
20564104 Taken together, their findings demonstrated that both epigenetic and genetic mechanisms were involved in silencing CHFR expression in EACs.
20473935 results demonstrate that CHFR loss might be critical for the tumorigenesis of NSCLC in patients with a history of smoking and induces tumors of a more malignant phenotype than the EGFR mutation
20388495 this is the first report identifying the regulatory mechanism of HLTF by CHFR, suggesting that CHFR-mediated downregulation of HLTF may help protect against cancer.
20300977 Aberrant promoter methylation of Runx3 and CHFR genes may be involved in the carcinogenesis and development of gastric cancer
20109344 Aberrant methylation of the CHFR gene is a frequent event in the carcinogenesis of gastric cancer.
20082478 Gene methylation (CHFR, E-cadherin, BNIP3) in the peritoneal fluid could detect occult neoplastic cells in the peritoneum and might be a risk factor for peritoneal metastasis.
19787237 Aberrant promoter hypermethylation of the CHFR gene is associated with oral squamous cell carcinomas.
19634111 analysis of CHFR promoter hypermethylation and reduced CHFR mRNA expression in ovarian cancer
19584075 Observational study of gene-disease association. (HuGE Navigator)
19469003 Data show that the promoter methylation of CHFR was frequently accompanied with microsatellite instability, but not with clinicopathological factors in gastric cancer.
19448676 These results indicate that expression of CHFR markedly reduces the expression of IL-8 through the inhibition of NF-kappaB.
19182791 Chfr functions as a tumour suppressor by regulating HDAC1.
18763281 Aberrant methylation of the CHFR gene may be involved in the carcinogenesis and development of gastric cancer, and is the predominant cause of down-regulation or loss of CHFR mRNA or protein expression
18623126 results suggest the aberrant expression of Aurora-A and/or of CHFR contributed to the increase in the malignant potential of NSCLC, and that CHFR expression was impaired in smoking-related squamous cell carcinoma and might be a useful marker in NSCLC
18592005 A novel role for CHFR regulating chromosome segregation where decreased expression, as seen in cancer cells, contributes to genomic instability by impairing the spindle assembly checkpoint.
18504434 The Chfr-TCTP interaction was stable throughout the cell cycle, but it could be diminished by the complete depolymerization of the microtubules.
18335050 confirmed that the FHA domain of CHFR plays an important role in initiating a cell cycle arrest at G2/M, indicating a functional link exists between the anti-proliferative effects and checkpoint function of this tumor suppressor protein via this domain
18172500 interaction of poly(ADP-ribose) with a PBZ motif in two representative human proteins, APLF (aprataxin PNK-like factor) and CHFR (checkpoint protein with FHA and RING domains)
18079053 Reveal for the first time that polymorphisms in the CHFR gene are associated with colorectal cancer susceptibility.
18079053 Observational study of gene-disease association. (HuGE Navigator)
17786301 Epigenetic inactivation of the CHFR gene in cervical cancer contributes to sensitivity to taxanes
17673375 CHFR gene is neither mutated nor hypermethylated in ovarian cancer
17596595 CHFR has a role as a tumor suppressor in breast cancer
17442268 Chfr activation by USP7 may play an important role in the regulation of Chfr-mediated cellular processes including cell cycle progression and tumor suppression.
17201143 CHFR might act as a tumor suppressor in at least some colorectal cancers and that CHFR methylation might, therefore, be a particular phenomenon of early colorectal cancer
16554732 Results support the assertion that CHFR functions as an inhibitor of tumor proliferation.
15937956 downregulation of CHFR is a common event in nasopharyngeal carcinoma cells which may be due to hypermethylation of the gene promoter region
15760919 The loss of checkpoint control associated with methylation of CHFR suggests the potential to overcome cell cycle checkpoints, which may lead to an accumulation of mutations.
15674323 We conclude that the mechanism by which CHFR delays chromosome condensation involves inhibition of accumulation of Cyclin B1 in the nucleus.
15467728 PML bodies control the distribution, dynamics and function of CHFR
15302856 CHFR has a role in blocking mitosis along with p38 MAP kinase
15201973 Aberrant promoter methylation of the CHFR gene was observed in a significant proportion of human gastric cancers.
14654793 Chfr is frequently inactivated in colon but not breast cancers, through a mechanism of hypermethylation of the promoter sequences.
14612512 That the chfr gene is frequently silenced in various tumors because of methylation of its promoter, these findings suggest that chfr is inactivated by multiple mechanisms in human cancer.
14562038 Chfr may have a role in signaling the presence of mitotic stress induced by microtubule poisons
12810945 CHFR has a role in mitotic checkpoint control
12538348 Frequent hypermethylation of the 5' CpG island of the mitotic stress checkpoint gene Chfr in colorectal and non-small cell lung cancer.
12376479 expression is downregulated by CpG island hypermethylation in esophageal cancer
11912157 Chfr regulates a mitotic stress pathway through its RING-finger domain with ubiquitin ligase activity.
11807090 checkpoint protein Chfr is a ligase that ubiquitinates Plk1 and inhibits Cdc2 at the G2 to M transition

AA Sequence

MERPEEGKQSPPPQPWGRLLRLGAEEGEPHVLLRKREWTIGRRRGCDLSFPSNKLVSGDHCRIVVDEKSG      1 - 70
QVTLEDTSTSGTVINKLKVVKKQTCPLQTGDVIYLVYRKNEPEHNVAYLYESLSEKQGMTQESFEANKEN     71 - 140
VFHGTKDTSGAGAGRGADPRVPPSSPATQVCFEEPQPSTSTSDLFPTASASSTEPSPAGRERSSSCGSGG    141 - 210
GGISPKGSGPSVASDEVSSFASALPDRKTASFSSLEPQDQEDLEPVKKKMRGDGDLDLNGQLLVAQPRRN    211 - 280
AQTVHEDVRAAAGKPDKMEETLTCIICQDLLHDCVSLQPCMHTFCAACYSGWMERSSLCPTCRCPVERIC    281 - 350
KNHILNNLVEAYLIQHPDKSRSEEDVQSMDARNKITQDMLQPKVRRSFSDEEGSSEDLLELSDVDSESSD    351 - 420
ISQPYVVCRQCPEYRRQAAQPPHCPAPEGEPGAPQALGDAPSTSVSLTTAVQDYVCPLQGSHALCTCCFQ    421 - 490
PMPDRRAEREQDPRVAPQQCAVCLQPFCHLYWGCTRTGCYGCLAPFCELNLGDKCLDGVLNNNSYESDIL    491 - 560
KNYLATRGLTWKNMLTESLVALQRGVFLLSDYRVTGDTVLCYCCGLRSFRELTYQYRQNIPASELPVAVT    561 - 630
SRPDCYWGRNCRTQVKAHHAMKFNHICEQTRFKN                                        631 - 664
//

Text Mined References (82)

PMID Year Title
26542416 2016 CHFR hypermethylation, a frequent event in acute myeloid leukemia, is independently associated with an adverse outcome.
26356822 2015 Small molecule inhibition of the CHFR-PARP1 interaction as novel approach to overcome intrinsic taxane resistance in cancer.
25828518 2015 CHFR methylation strongly correlates with methylation of DNA damage repair and apoptotic pathway genes in non-small cell lung cancer.
25798877 2015 Aberrant expression of the CHFR prophase checkpoint gene in human B-cell non-Hodgkin lymphoma.
25304615 2015 Three novel fusion transcripts of the paired box 5 gene in B-cell precursor acute lymphoblastic leukemia.
24928946 2014 CHFR promoter methylation indicates poor prognosis in stage II microsatellite stable colorectal cancer.
24748501 2015 Predictive value of CHFR and MLH1 methylation in human gastric cancer.
24684796 2014 Heritability and genetic association analysis of cognition in the Diabetes Heart Study.
24639283 2014 Association between CHFR methylation and chemosensitivity of paclitaxel in advanced gastric cancer.
24375389 2014 Emerging evidence for CHFR as a cancer biomarker: from tumor biology to precision medicine.
24012691 2013 TOPK and PTEN participate in CHFR mediated mitotic checkpoint.
23873170 2014 CHFR silencing or microsatellite instability is associated with increased antitumor activity of docetaxel or gemcitabine in colorectal cancer.
23454125 2013 CHFR is negatively regulated by SUMOylation-mediated ubiquitylation.
23415374 2013 CHFR aberrant methylation involves a subset of human lung adenocarcinoma associated with poor clinical outcomes.
23386692 2013 CHFR protein expression predicts outcomes to taxane-based first line therapy in metastatic NSCLC.
23241409 2013 Aggregated low-density lipoprotein induces LRP1 stabilization through E3 ubiquitin ligase CHFR downregulation in human vascular smooth muscle cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23131550 2013 SUMOylation negatively regulates the stability of CHFR tumor suppressor.
22469813 2012 RNA interference targeting CHFR enhances taxol chemosensitivity in endometrial cancer cells.
22337872 2012 CHFR protein regulates mitotic checkpoint by targeting PARP-1 protein for ubiquitination and degradation.
22159584 2012 CHFR: a key checkpoint component implicated in a wide range of cancers.
22070084 2011 [Aberrant promoter hypermethylation of CHFR in nasopharyngeal carcinoma].
21768102 2011 The auto-ubiquitylation of E3 ubiquitin-protein ligase Chfr at G2 phase is required for accumulation of polo-like kinase 1 and mitotic entry in mammalian cells.
21575600 2011 CHFR binds to and regulates MAD2 in the spindle checkpoint through its cysteine-rich domain.
21551253 2011 Association of CHFR promoter methylation with disease recurrence in locally advanced colon cancer.
21409489 2011 Aberrant gene methylation is a biomarker for the detection of cancer cells in peritoneal wash samples from advanced gastric cancer patients.
21302620 Promoter methylation of p16, Runx3, DAPK and CHFR genes is frequent in gastric carcinoma.
20942233 2010 [Study of mRNA expression level and hypermethylation of CHFR promoter in the laryngeal squamous cell carcinoma tissue].
20880844 2010 Structural basis of poly(ADP-ribose) recognition by the multizinc binding domain of checkpoint with forkhead-associated and RING Domains (CHFR).
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20564104 2010 Epigenetic and genetic silencing of CHFR in esophageal adenocarcinomas.
20473935 2011 CHFR hypermethylation and EGFR mutation are mutually exclusive and exhibit contrastive clinical backgrounds and outcomes in non-small cell lung cancer.
20388495 2010 CHFR functions as a ubiquitin ligase for HLTF to regulate its stability and functions.
20300977 2011 Pathobiologic implications of methylation and expression status of Runx3 and CHFR genes in gastric cancer.
20109344 2010 Promoter methylation of CHFR gene in gastric carcinoma tissues detected using two methods.
20082478 2010 Aberrant gene methylation in the peritoneal fluid is a risk factor predicting peritoneal recurrence in gastric cancer.
19787237 2009 Aberrant promoter hypermethylation of the CHFR gene in oral squamous cell carcinomas.
19634111 CHFR promoter hypermethylation and reduced CHFR mRNA expression in ovarian cancer.
19584075 2009 Novel susceptibility loci for second primary tumors/recurrence in head and neck cancer patients: large-scale evaluation of genetic variants.
19469003 2009 Checkpoint with forkhead-associated and ring finger promoter hypermethylation correlates with microsatellite instability in gastric cancer.
19448676 2009 CHFR, a potential tumor suppressor, downregulates interleukin-8 through the inhibition of NF-kappaB.
19182791 2009 Chfr is linked to tumour metastasis through the downregulation of HDAC1.
18763281 2008 Mechanism and pathobiologic implications of CHFR promoter methylation in gastric carcinoma.
18623126 2008 CHFR expression is preferentially impaired in smoking-related squamous cell carcinoma of the lung, and the diminished expression significantly harms outcomes.
18592005 2008 Loss of CHFR in human mammary epithelial cells causes genomic instability by disrupting the mitotic spindle assembly checkpoint.
18504434 2008 Chfr interacts and colocalizes with TCTP to the mitotic spindle.
18335050 2008 The anti-proliferative effects of the CHFR depend on the forkhead associated domain, but not E3 ligase activity mediated by ring finger domain.
18172500 2008 Poly(ADP-ribose)-binding zinc finger motifs in DNA repair/checkpoint proteins.
18079053 2008 Coding region polymorphisms in the CHFR mitotic stress checkpoint gene are associated with colorectal cancer risk.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17786301 2007 Epigenetic inactivation of the CHFR gene in cervical cancer contributes to sensitivity to taxanes.
17673375 2007 CHFR gene is neither mutated nor hypermethylated in ovarian cancer.
17596595 2007 Altered expression of the early mitotic checkpoint protein, CHFR, in breast cancers: implications for tumor suppression.
17442268 2007 Deubiquitination of Chfr, a checkpoint protein, by USP7/HAUSP regulates its stability and activity.
17201143 Aberrant methylation of the CHFR gene is frequently detected in non-invasive colorectal cancer.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16554732 2006 Aberrant expression of CHFR in malignant peripheral nerve sheath tumors.
16541075 2006 The finished DNA sequence of human chromosome 12.
15937956 2005 Epigenetic inactivation of CHFR in nasopharyngeal carcinoma through promoter methylation.
15760919 2005 CHFR promoter hypermethylation in colon cancer correlates with the microsatellite instability phenotype.
15674323 2005 The CHFR mitotic checkpoint protein delays cell cycle progression by excluding Cyclin B1 from the nucleus.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15467728 2004 PML bodies control the nuclear dynamics and function of the CHFR mitotic checkpoint protein.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15302856 2004 Chfr acts with the p38 stress kinases to block entry to mitosis in mammalian cells.
15201973 2004 Promoter hypermethylation and silencing of CHFR mitotic stress checkpoint gene in human gastric cancers.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14695171 2003 Epigenetic inactivation of CHFR and sensitivity to microtubule inhibitors in gastric cancer.
14694445 2004 CHFR-associated early G2/M checkpoint defects in breast cancer cells.
14654793 2003 Chfr inactivation is not associated to chromosomal instability in colon cancers.
14638868 2003 Promotion of mitosis by activated protein kinase B after DNA damage involves polo-like kinase 1 and checkpoint protein CHFR.
14612512 2003 Inactivating mutations targeting the chfr mitotic checkpoint gene in human lung cancer.
14562038 2003 The Chfr mitotic checkpoint protein functions with Ubc13-Mms2 to form Lys63-linked polyubiquitin chains.
12810945 2003 Epigenetic inactivation of CHFR in human tumors.
12538348 2003 Frequent hypermethylation of the 5' CpG island of the mitotic stress checkpoint gene Chfr in colorectal and non-small cell lung cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12376479 2002 Chfr expression is downregulated by CpG island hypermethylation in esophageal cancer.
12121644 2002 Crystal structure of the FHA domain of the Chfr mitotic checkpoint protein and its complex with tungstate.
11948416 2002 Aberrant hypermethylation of the CHFR prophase checkpoint gene in human lung cancers.
11912157 2002 Chfr regulates a mitotic stress pathway through its RING-finger domain with ubiquitin ligase activity.
11807090 2002 The checkpoint protein Chfr is a ligase that ubiquitinates Plk1 and inhibits Cdc2 at the G2 to M transition.
10935642 2000 Chfr defines a mitotic stress checkpoint that delays entry into metaphase.