Property Summary

NCBI Gene PubMed Count 13
PubMed Score 7.33
PubTator Score 7.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
juvenile dermatomyositis 1187 1.8e-08
osteosarcoma 7950 6.3e-05
acute quadriplegic myopathy 1158 1.1e-04
lung cancer 4740 3.1e-04
psoriasis 6694 4.4e-04
astrocytoma 1146 7.0e-04
breast carcinoma 1638 1.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (7)

Disease log2 FC p
acute quadriplegic myopathy 1.259 1.1e-04
astrocytoma 2.100 7.0e-04
breast carcinoma 1.100 1.9e-02
juvenile dermatomyositis 1.027 1.8e-08
lung cancer 1.200 3.1e-04
osteosarcoma 1.026 6.3e-05
psoriasis -1.100 4.4e-04

Gene RIF (3)

AA Sequence

MEMPLPPDDQELRNVIDKLAQFVARNGPEFEKMTMEKQKDNPKFSFLFGGEFYSYYKCKLALEQQQLICK      1 - 70
QQTPELEPAATMPPLPQPPLAPAAPIPPAQGAPSMDELIQQSQWNLQQQEQHLLALRQEQVTAAVAHAVE     71 - 140
QQMQKLLEETQLDMNEFDNLLQPIIDTCTKDAISAGKNWMFSNAKSPPHCELMAGHLRNRITADGAHFEL    141 - 210
RLHLIYLINDVLHHCQRKQARELLAALQKVVVPIYCTSFLAVEEDKQQKIARLLQLWEKNGYFDDSIIQQ    211 - 280
LQSPALGLGQYQATLINEYSSVVQPVQLAFQQQIQTLKTQHEEFVTSLAQQQQQQQQQQQQLQMPQMEAE    281 - 350
VKATPPPPAPPPAPAPAPAIPPTTQPDDSKPPIQMPGSSEYEAPGGVQDPAAAGPRGPGPHDQIPPNKPP    351 - 420
WFDQPHPVAPWGQQQPPEQPPYPHHQGGPPHCPPWNNSHEGMWGEQRGDPGWNGQRDAPWNNQPDAAWNS    421 - 490
QFEGPWNSQHEQPPWGGGQREPPFRMQRPPHFRGPFPPHQQHPQFNQPPHPHNFNRFPPRFMQDDFPPRH    491 - 560
PFERPPYPHRFDYPQGDFPAEMGPPHHHPGHRMPHPGINEHPPWAGPQHPDFGPPPHGFNGQPPHMRRQG    561 - 630
PPHINHDDPSLVPNVPYFDLPAGLMAPLVKLEDHEYKPLDPKDIRLPPPMPPSERLLAAVEAFYSPPSHD    631 - 700
RPRNSEGWEQNGLYEFFRAKMRARRRKGQEKRNSGPSRSRSRSKSRGRSSSRSNSRSSKSSGSYSRSRSR    701 - 770
SCSRSYSRSRSRSRSRSRSSRSRSRSQSRSRSKSYSPGRRRRSRSRSPTPPSSAGLGSNSAPPIPDSRLG    771 - 840
EENKGHQMLVKMGWSGSGGLGAKEQGIQDPIKGGDVRDKWDQYKGVGVALDDPYENYRRNKSYSFIARMK    841 - 910
ARDECK                                                                    911 - 916
//

Text Mined References (26)

PMID Year Title