Property Summary

Ligand Count 863
NCBI Gene PubMed Count 398
PubMed Score 1089.60
PubTator Score 805.37

Knowledge Summary

Patent (55,198)

TINX Plot

  Disease (5)

Expression

  Differential Expression (27)

Disease log2 FC p
adrenocortical carcinoma 1.007 2.3e-02
adult high grade glioma 1.800 1.9e-04
Atopic dermatitis 1.200 1.8e-03
atypical teratoid / rhabdoid tumor 3.000 7.7e-09
Breast cancer 1.100 4.0e-05
colon cancer 2.000 7.3e-04
cystic fibrosis 1.411 7.8e-06
ductal carcinoma in situ 1.300 7.0e-03
Endometriosis 1.029 3.3e-02
ependymoma 1.200 5.1e-06
glioblastoma 2.300 3.6e-07
group 3 medulloblastoma 3.600 2.4e-06
intraductal papillary-mucinous carcinoma... 1.100 3.2e-03
intraductal papillary-mucinous neoplasm ... 2.600 8.9e-05
invasive ductal carcinoma 1.700 1.9e-03
lung adenocarcinoma 1.400 4.5e-10
lung cancer 2.100 4.6e-05
malignant mesothelioma 1.100 2.5e-06
medulloblastoma, large-cell 3.600 9.5e-08
nasopharyngeal carcinoma 1.300 3.4e-03
non-small cell lung cancer 2.126 4.9e-25
ovarian cancer 1.600 1.4e-03
pancreatic cancer 1.200 8.9e-04
primitive neuroectodermal tumor 3.100 2.0e-05
psoriasis 1.500 1.5e-03
tuberculosis and treatment for 6 months 1.200 3.5e-02
ulcerative colitis 1.100 6.3e-04

PDB (129)

Gene RIF (352)

AA Sequence

MAVPFVEDWDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMKRAVDCPENIKKEICINKMLNHENVVKF      1 - 70
YGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEPDAQRFFHQLMAGVVYLHGIGITHRDIKPENLLLDE     71 - 140
RDNLKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLKRREFHAEPVDVWSCGIVLTAMLAGELPWDQ    141 - 210
PSDSCQEYSDWKEKKTYLNPWKKIDSAPLALLHKILVENPSARITIPDIKKDRWYNKPLKKGAKRPRVTS    211 - 280
GGVSESPSGFSKHIQSNLDFSPVNSASSEENVKYSSSQPEPRTGLSLWDTSPSYIDKLVQGISFSQPTCP    281 - 350
DHMLLNSQLLGTPGSSQNPWQRLVKRMTRFFTKLDADKSYQCLKETCEKLGYQWKKSCMNQVTISTTDRR    351 - 420
NNKLIFKVNLLEMDDKILVDFRLSKGDGLEFKRHFLKIKGKLIDIVSSQKIWLPAT                  421 - 476
//

Text Mined References (416)

PMID Year Title