Property Summary

NCBI Gene PubMed Count 369
PubMed Score 1014.60
PubTator Score 805.37

Knowledge Summary

Patent (55,198)

Expression

  Differential Expression (27)

Disease log2 FC p
malignant mesothelioma 1.100 2.5e-06
psoriasis 1.600 4.5e-13
glioblastoma 2.900 4.8e-10
posterior fossa group A ependymoma 1.700 1.5e-07
group 3 medulloblastoma 3.600 2.4e-06
cystic fibrosis 1.411 7.8e-06
atypical teratoid / rhabdoid tumor 3.100 8.0e-11
medulloblastoma, large-cell 3.800 6.4e-09
primitive neuroectodermal tumor 3.100 2.0e-05
Atopic dermatitis 1.500 7.0e-04
adrenocortical carcinoma 1.332 3.6e-03
tuberculosis and treatment for 6 months 1.200 3.5e-02
non-small cell lung cancer 2.471 3.8e-28
intraductal papillary-mucinous carcinoma... 1.100 3.2e-03
intraductal papillary-mucinous neoplasm ... 2.600 8.9e-05
lung cancer 3.700 7.8e-06
colon cancer 2.000 7.3e-04
pancreatic cancer 1.200 8.9e-04
lung adenocarcinoma 1.400 4.5e-10
pediatric high grade glioma 2.800 7.9e-07
nasopharyngeal carcinoma 1.300 3.4e-03
Endometriosis 1.029 3.3e-02
Breast cancer 2.000 3.1e-09
ductal carcinoma in situ 1.300 7.0e-03
invasive ductal carcinoma 2.200 1.2e-03
ulcerative colitis 1.100 6.3e-04
ovarian cancer 2.100 6.7e-09

Synonym

Accession O14757 A8K934 B4DDD0 B4DSK3 B5BTY6 F5H7S4 H2BI51
Symbols CHK1

Gene

PDB

1IA8   1NVQ   1NVR   1NVS   1ZLT   1ZYS   2AYP   2BR1   2BRB   2BRG   2BRH   2BRM   2BRN   2BRO   2C3J   2C3K   2C3L   2CGU   2CGV   2CGW   2CGX   2E9N   2E9O   2E9P   2E9U   2E9V   2GDO   2GHG   2HOG   2HXL   2HXQ   2HY0   2QHM   2QHN   2R0U   2WMQ   2WMR   2WMS   2WMT   2WMU   2WMV   2WMW   2WMX   2X8D   2X8E   2X8I   2XEY   2XEZ   2XF0   2YDI   2YDJ   2YDK   2YER   2YEX   2YM3   2YM4   2YM5   2YM6   2YM7   2YM8   2YWP   3F9N   3JVR   3JVS   3NLB   3OT3   3OT8   3PA3   3PA4   3PA5   3TKH   3TKI   3U9N   4FSM   4FSN   4FSQ   4FSR   4FST   4FSU   4FSW   4FSY   4FSZ   4FT0   4FT3   4FT5   4FT7   4FT9   4FTA   4FTC   4FTI   4FTJ   4FTK   4FTL   4FTM   4FTN   4FTO   4FTQ   4FTR   4FTT   4FTU   4GH2   4HYH   4HYI   4JIK   4QYE   4QYF   4QYG   4QYH   4RVK   4RVL   4RVM   5DLS   5F4N  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

  TechDev Info (1)

Gary Johnson 302 Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (324)

PMID Text
27129240 This study shows that Chk1 indeed maintains a closed conformation in the absence of DNA damage through an intramolecular interaction between a region (residues 31-87) at the N-terminal kinase domain and the distal C terminus. A highly conserved Leu-449 at the C terminus is important for this intramolecular interaction.
26921499 We suggest that MNNG-stimulated ATR/CHK1 signaling stabilizes E2F3 by S124 phosphorylation, and then E2F3 together with NFY co-transactivate RRM2 expression for DNA repair.
26810087 Human induced pluripotent stem cells fail to activate CHK1 when exposed to DNA replication inhibitors and commit to apoptosis instead.
26804904 Avoiding damage formation through invalidation of Mus81-Eme2 and Mre11, or preventing damage signaling by turning off the ATM pathway, suppresses the replication phenotypes of Chk1-deficient cells.
26748709 In conclusion, this study exemplifies cancer-specific synthetic lethality between two proteins in the same pathway and raises the prospect of combining ATR and CHK1 inhibitors as promising cancer therapy.
26693937 A new pathway of proliferation restriction for tetraploid untransformed cells that seems to be specific for loss of adhesion dependent cytokinesis failure involves Chk1 and p53 activation during G2.
26667770 RAD9 has a prominent role in the ATR-Chk1 pathway that is necessary for successful formation of the damage-sensing complex and DNA damage checkpoint signaling.
26658951 these results demonstrate a positive feedback loop involving Rad9A-dependend activation of Chk1.
26542114 Results support the inhibition of checkpoint kinase 1 (Chk1) as a new therapeutic strategy in acute lymphoblastic leukemia.
26459098 Chk1 is a predictive biomarker of radiotherapy resistance and early local recurrence.
26439697 Isolate/characterize mantle cell lymphoma cell line resistance to Chk1 inhibitor PF-00477736.
26365377 ATR inhibition induces moderate ssDNA and triggers a DNA-PK and Chk1-mediated backup pathway to suppress origin firing.
26296656 DNA damage induces Chk1 phosphorylation on chromatin followed by releasing phospho-Chk1 from the chromatin into soluble nucleus and the cytoplasm where Chk1 activates the cell cycle checkpoints; and Chk1 is degraded and checkpoint signaling is terminated.
26141863 Our study reveals a level of mechanistic complexity that offers conceptually important insights into the dynamic interplay between gemcitabine and CHK1 inhibition.
26061604 Via activation of the ATM/ATR-Chk1/Chk2 check point pathway.
26039276 mutations targeting the putative Chk1 KA1 domain confer constitutive biological activity by circumventing the need for ATR-mediated positive regulatory phosphorylation.
26025928 nasopharyngeal carcinoma cells depend on CHK1 and WEE1 activity for growth
25966274 These findings indicated that mangiferin inhibits cell cycle progression through the ATR-Chk1 stress response DNA damage pathway, leading to cell cycle arrest at G2/M phase in leukemia cells
25904336 ATR activity in midbody-stage cells links postmitotic genome surveillance to abscission timing and that Chk1 integrates this and other signals upstream of Aurora B to regulate when the final step in the physical separation of daughter cells occurs.
25884494 Our findings suggest that the addition of CHEK1 inhibitor increases the response of ovarian cancer cells to TPT. Furthermore, reduced dosages of both drugs achieved maximal cytotoxic effects by combining TPT with CHEK1 inhibitor.
25840419 CHEK1 was a direct target of miR-195, which decreased CHEK1 expression in lung cancer cells. High expression of CHEK1 in lung tumors was associated with poor overall survival.
25809478 normal DNA replication and replication checkpoint activation is regulated through the novel phosphorylation of MCM3 by Chk1
25795119 The review summarizes Chk1 role as a multifaceted and versatile signaling factor that acts at ongoing forks and replication origins to determine the extent and quality of the cellular response to replication stress.
25757065 The findings implicate Aven in ATR-Chk1 signalling and point towards Chk1 inhibition as a strategy to sensitize human osteosarcomas to chemotherapy.
25690891 Findings suggest a role of checkpoint kinase 1 (CHK1) as an histone H3.3 serine 31 kinase.
25688741 Data suggest that pCHK1 may have prognostic and predictive significance in breast cancer. Subcellular localisation of pCHK1 protein is related to its function.
25653093 Suppression of CHK1 by ETS Family Members Promotes DNA Damage Response Bypass and Tumorigenesis
25557548 Results show that Chk1 negatively regulates the Treslin-mediated loading of Cdc45 onto chromatin and thereby serves to antagonize the initiation of replication.
25483185 The suppression of PKC activates the Chk1-mediated mitotic exit checkpoint in Nf1-deficient cells, leading to the induction of apoptosis via mitotic catastrophe.
25483076 Chk1 negatively regulates immunoglobulin somatic hypermutation and gene conversion.
25474241 Results revealed a novel interplay between IKKepsilon, CHEK1 and p21 signaling in survival of ovarian cancer cells.
25468710 ATR and CHEK1 are promising biomarkers and rational drug targets for personalized therapy in breast cancer.
25460505 these results suggest that breast cancer cells may rely on mTORC2-Chk1 pathway for survival
25459351 PhosphoChk1 and H2AX are useful biomarkers for ATR inhibition using a variety of immuno-detection methods, but timing may be critical
25444911 Inhibition of UNC45A expression reduced ChK1 activation and its tethering to the centrosome, events required for proper centrosome function.
25428911 Report strong synergism observed by combining Chk1 and Wee1 inhibitors in preclinical models of mantle cell lymphoma.
25375241 Findings suggest that the Chk1/Ribonucleotide reductase replication complex is a key component of the replication checkpoint.
25336189 these compounds did not inhibit ATR catalytic activity in vitro, unlike typical ATP-competitive inhibitors, but acted in a mechanistically distinct manner to disable ATR-Chk1 function
25312395 we report that SPB07479 appear promising for further development of Chk1 inhibitors. This study also highlights the role of conserved water molecules in the active site of Chk1 for the successful identification of novel inhibitors
25249323 Chk1 activation leads to phosphorylation of Smurf1 that enhances its self-degradation, hence resulting in a RhoB accumulation to promote apoptosis.
25208576 Dual Tra2 protein depletion reduces expression of full-length CHK1 protein, results in the accumulation of the DNA damage marker gammaH2AX and decreased cell viability.
25132270 Results show that CHK1 is overexpressed and critical for T-cell acute lymphoblastic leukemia proliferation and viability by downmodulating replication stress and preventing ATM/caspase-3-dependent cell death.
25086746 ZEB1 is an ATM substrate linking ATM to CHK1 and the mechanism underlying the association between epithelial-mesenchymal transition and radioresistance.
25084614 Our study provides compelling evidence that CHK1 plays a critical role in the anti-leukemic activity of MK-1775
25049228 phosphorylation of Chk1 at ATR sites reduces the interaction between Chk1 and the MCM complex, facilitating chromatin release of phosphorylated Chk1, a critical step in the initiation and amplification of cell cycle checkpoint
25015292 Chk1 phosphorylates BLM-S502 to inhibit cullin-3-mediated BLM degradation during interphase.
25012639 Chk1 activity is required for BAK multimerization in association with PUMA during mitochondrial apoptosis
24971465 CCNB1 is activated by Chk1, exerts its oncogenic role in colorectal cancer cells, and may play a key role in the development of a novel therapeutic approach against colorectal cancer.
24923443 USP20 and Rad17 interact, and that this interaction is enhanced by UV exposure. We show that USP20 regulation of Rad17 is at the protein level in a proteasome-dependent manner. USP20 depletion results in poor activation of Chk1 protein by phosphorylation
24913641 These data support the further evaluation of Chk1 inhibitors in hematopoietic cancers as single agents as well as in combination with standard of care cytotoxic drugs.
24894074 The results of this study provide the first clear information regarding the effects of Chk1 inhibition on radiation-induced G2 arrest, with special focus on the time dimension.
24853623 selective targeting of Chk1 and Chk2 by oncolytic adenovirus mutants was chosen to treat resistant tumor xenograft mice, and the maximum antitumoral efficacy was achieved with the combined co-abrogation of Chk1 and Chk2
24853431 Suggest a novel role for CHK1 in the control of Aurora B activation during DNA replication stress and support the idea that premature mitosis is a distinct cell fate triggered by the disruption of DNA replication when CHK1 function is suppressed.
24823293 Data suggest carcinoma cells initiate S phase arrest/autophagy as pro-survival responses to DNA damage (via antineoplastic drug); suppression of autophagy (via antineoplastic drug) enhances apoptosis via disruption of CHK1-dependent S phase arrest.
24810059 Combined inhibition of PDK1 and CHK1 represents a potentially effective therapeutic approach to reduce the growth of human glioblastoma.
24795708 HIV-1 Vpr activates ATR, resulting in phosphorylation of Chk1 and activation of the ATR-mediated DNA damage response
24762558 Fos expression protects osteoblasts from RS and DNA damage likely through upregulation of Chk1 and facilitates transformation by Ras/E1A oncogenes.
24747134 Chk1 is required for metaphase-anaphase transition via regulating expression of Cdc20 and Mad2.
24744753 HIV-1 Vpr activates ATR, resulting in phosphorylation of Chk1 and activation of the ATR-mediated DNA damage response
24650757 Diallyl disulfide may specifically modulate Chk1 phosphorylation, and Diallyl disulfide induced G2/M phase arrest in BGC823 cells could result in part from Chk1-mediated inhibition of the Cdc25C/cyclin B1 pathway.
24639502 STAT3 interrupts ATR-to-Chk1 signaling by promoting loss of Claspin, a protein that assists ATR to phosphorylate Chk1.
24636978 Chk1 gene significantly overexpressed in Triple Negative Breast Cancers. Depletion of Chk1 protein expression induced reduction of cell viability and led to mitotic cell death.
24634213 Data indicate that inhibition of Src activity induces persistent activation of ataxia telangiectasia mutated (ATM)- and Rad3-related (ATR) and check point kinase 1 (Chk1).
24464213 High CHEK1 expression is associated with hepatocellular carcinoma.
24441772 It regulates signaling pathway in human lung cancercells.
24336073 miR-16 and miR-26a target checkpoint kinases Wee1 and Chk1 in response to p53 activation by genotoxic stress.
24327542 Distal 11q loss is a useful biomarker in OSCC for radioresistance that can be reversed by ATR-CHEK1 pathway inhibition.
24244429 results establish a novel mechanism underlying the cooperative antileukemic activities of these drug combinations in which panobinostat suppresses expression of BRCA1, CHK1, and RAD51 to enhance cytarabine and daunorubicin sensitivities in AML cells.
24197116 CHK1-mediated phosphorylation of RASSF1A, at Serine 184, plays an important role in cell-cycle regulation and mutation of this CHK1 phosphorylation site in nasopharyngeal carcinoma has disease relevance.
24158981 KIM-1 expression increased significantly in a manner that corresponded temporally and regionally with increased phosphorylation of checkpoint kinase 1 (Chk1) and STAT3 in acute kidney injury.
24158819 HIV-1 Vpr activates ATR, resulting in phosphorylation of Chk1 and activation of the ATR-mediated DNA damage response
24117075 It is a novel molecular targe of Wedelia chinensis extract in nasopharyngeal carcinoma cells.
24113549 elevated expression in lung adenocarcinomas correlates with poor patient survival
24098799 Suppression of the CHK1 pathway by panobinostat is at least partially responsible for the synergistic antitumor interactions between panobinostat and the DNA damaging agents in high-risk neuroblastoma cells.
24002546 These findings indicate that DHM inhibits the growth of hepatocellular carcinoma (HCC) cells via G2/M phase cell cycle arrest through Chk1/Chk2/Cdc25C pathway
23954429 After replication stress, the checkpoint kinase Chk1 phosphorylates E2F6, leading to its dissociation from promoters. This promotes E2F-dependent transcription, which mediates cell survival by preventing DNA damage and cell death
23932155 Abrogation of the G2 checkpoint through the inhibition of Chk1 may be used to selectively increase the cellular radiosensitivity of HPV-positive HNSCC without affecting the surrounding normal tissue.
23844225 common alleles of ATR and CHEK1 are not implicated in breast cancer risk or survival, but we cannot exclude effects of rare alleles and of common alleles with very small effect sizes.
23799366 DNA polymerase kappa-dependent DNA synthesis at stalled replication forks is important for CHK1 activation.
23798705 Che-1 depletion abolishes the ability of Chk1 to bind pericentrin and to localize at centrosomes, which, in its turn, deregulates the activation of centrosomal cyclin B-Cdk1 and advances entry into mitosis.
23748345 Pim kinases phosphorylate Chk1 and regulate its functions in acute myeloid leukemia.
23733185 Data indicate that 4-Hydroxynonenal (HNE) induces phosphorylation of telangiectasia mutated and Rad3-related protein (ATR) and checkpoint kinase 1 (Chk1).
23720738 Chk1 pathway is activated in MCM7-overexpressed cells in a p53-dependent manner.
23600770 Through the ATR-Chk1-Cdc25C and Weel pathways were the central mechanisms for G2 /M phase arrest in human colon cancer cells.
23536721 these findings indicate that the novel Chk1 inhibitor MK-8776 markedly potentiates HDACI lethality in leukemia cells displaying various genetic backgrounds
23533280 BTG3-dependent CHK1 ubiquitination contributes to its chromatin localization and activation and a defect in this regulation may increase genome instability and promote tumorigenesis
23454898 Chk1 co-localizes and physically associates with Mad2 in cells both under unstressed conditions and after DNA damage.
23447702 A feedforward mechanism that leads to G2 arrest identifies ATR and Chk1 as molecular agents of the requisite checkpoint.
23447674 UV-induced G2 checkpoint activation in this situation therefore relies on signalling via the p38 MAPK and ATR-Chk1 signalling cascades.
23383610 IRAK1, CHEK1 and BUB1 may play an important role in ovarian cancer.
23321637 Data propose that Chk1 and Mps1 jointly regulate Aurora-B, MCAK, Kif2b and Hec1 to correct merotelic attachments. These results suggest a role for Chk1 and Mps1 in error correction.
23269272 MYC regulation of CHK1 and CHK2 promotes radioresistance in a stem cell-like population of nasopharyngeal carcinoma cells.
23255133 ATR and CHK1 promote chromosomal stability by different mechanisms
23109433 CRL4 is a major regulator of CHK1 stability. CRL4CDT2 targets CHK1 for ubiquitination in the nucleoplasm, and for PCNA-independent degradation. CHK1 is required for G2 arrest in CDT2-depleted cells.
23085068 CASP and non-CASP family proteases intricately regulate cleavage for up-regulation of CHK1 kinase activity during PCD.
23068608 Findings suggest that checkpoint kinase 1 CHK1 mediates cell cycle checkpoint signals by both cis-autophosphorylation and trans-phosphorylation of downstream factors.
22942255 Loss-of-function and gain-of-function studies showed that miR-15 family members controlled the expression of WEE1 and CHK1.
22863316 findings identify claspin as an in vivo substrate for the BRCA1 E3 ligase and suggest that its modification selectively triggers CHK1 activation for the homology-directed repair of a subset of genotoxic lesions
22855742 Unique regulatory mechanisms of Chk1 phosphorylation; this suggests that expression of constitutively active Chk1 may represent a novel strategy to suppress tumor growth.
22743332 These data reveal that BRCA1 facilitates Chk1 phosphorylation and its partial chromatin dissociation following replication inhibition that is likely to be required for S-phase checkpoint signaling.
22692200 novel regulatory mechanisms that couple protein cellular localization with the checkpoint response and cell viability of Chk1.
22621920 Data indicate that acute myeloid leukemia differentiation can be induced through ATP depletion and the subsequent activation of DNA damage signaling through an ATR/Chk1-dependent and p53-independent pathway.
22585575 CHK1 phosphorylation of SYK(L) promoted its subsequent proteasomal degradation.
22556425 hypoxia can activate p53 through inactivation of MDMX by the ATR-Chk1-MDMX-14-3-3gamma pathway.
22553144 Human embryonic stem cells fail to activate CHK1 and commit to apoptosis in response to DNA replication stress.
22529391 Data show that the ability of checkpoint kinases Chk1 to promote replication fork progression on damaged DNA relies on its proliferating cell nuclear antigen (PCNA)-interacting motif, which is required for its release from chromatin after DNA damage.
22505024 These results suggest that Chk1 phosphorylates Mig-6 on Ser 251, resulting in the inhibition of Mig-6, and that Chk1 acts as a positive regulator of EGF signalling.
22469983 Results identify a crucial tumor suppressive role of miR-424 in the progression of cervical cancer at least partly via upreglating the expression of Chk1.
22435685 Studies indicate that the ATR-Chk1-Cdc25 pathway is the sole checkpoint route in a majority of cancer cells.
22433954 Detailed characterization of this genetic system revealed an important role for Chk1 in maintaining a normal cell cycle, thereby preventing the growth of subclones with increased ploidy.
22401965 The BRCA1/Chk1/p53 pathway mediated the upregulation of p21(Cip1/Waf1). We also demonstrated that the NO-mediated up-regulation of p21(Cip1/Waf1) was inversely correlated with the activation status of the p38MAPK pathway.
22357623 results suggest p90 RSK facilitates nuclear Chk1 accumulation through Chk1-Ser-280 phosphorylation and that this pathway plays an important role in the preparation for monitoring genetic stability during cell proliferation.
22231448 these data lend insight into the mechanism by which Chk1 enhances repair of DNA damage while at the same time repressing stalled replication fork restart.
22203733 Data indicate that SCH900776 is a selective Chk1 inhibitor that potently inhibits Chk1 and abrogates cell-cycle arrest.
22159421 WRN is required for the CHK1-mediated intra-S-phase checkpoint.
22134241 The combination of Chk1 and PARP1 inhibition selectively radiosensitizes p53 mutant pancreatic cancer cells.
22106282 Data show that checkpoint kinase 1 (Chk1) is an important factor in the resistance of normal cells, and some transformed cells, to histone deacetylase inhibitors (HDACi)-induced cell death.
22080164 Inhibition of checkpoint kinase 1 abrogates G2/M checkpoint activation and promotes apoptosis under heat stress.
22044003 These compounds show a promising inhibitory profile on Chk1.
21995812 Chk1 and FANCD2 signal equally and additively for senescence induction, while Chk1 is predominantly responsible for maintaining persistent cell cycle arrest.
21921034 genetic disruption of PP5 is associated with enhanced and prolonged phosphorylation of a single serine (Ser-345) on Chk1
21907702 These data indicate that Cdk-mediated phosphorytion is required for efficient Chk1 activation and multiple checkpoint proficiency.
21858151 Data show that Mus81/Eme1-dependent DNA damage--rather than a global increase in replication-fork stalling--is the cause of incomplete replication in Chk1-deficient cells.
21803008 LOH11CR2A, PIG8 and CHEK1 are candidate tumor suppressor genes associated with breast carcinoma and have significant clinical as well as prognostic importance.
21752283 Integrin subunits alpha5 and alpha6 regulate cell cycle by modulating the chk1 and Rb/E2F pathways to affect breast cancer metastasis.
21680529 identified a de novo role for ATR-Chk1 and DNA-PK signaling in B19V DNA replication in primary human erythroid progenitor cells
21628425 nuclear but not centrosomal Chk1 contributes to correct timing of mitotic entry.
21615992 These results suggest that human MutY homolog may interact with ATR and function as a mediator of Chk1 phosphorylation in response to DNA damage.
21557990 a direct role of Chk1 in maintaining normal hematopoiesis in the bone marrow.
21532626 Data show that in MCF7 cells, both ATM (p53, p21) and ATR (Chk1) pathways are defective leading to a complete lack of G2 arrest in response to bleomycin and ICRF-193.
21502314 Tethering DNA damage checkpoint mediator proteins topoisomerase IIbeta-binding protein 1 (TopBP1) and Claspin to DNA activates ataxia-telangiectasia mutated and RAD3-related (ATR) phosphorylation of checkpoint kinase 1 (Chk1).
21440578 Results indicate that glucose deprivation induces ubiquitin-mediated Chk1 degradation and defective checkpoint responses, implying its potential role in genomic instability and tumor development.
21401699 The data suggest that CHK1 deletion is an early genetic event in the development of breast cancer and can be detected at the ductal carcinoma in situ stage.
21389083 USP1-regulated and damage-specific DNA-binding protein 1 (DDB1)-dependent mechanisms that are involved in the downregulation of activated CHK1 in human cells.
21383502 Genomic DNA damage and ATR-Chk1 signaling determine oncolytic adenoviral efficacy in ovarian cancer cells.
21301228 studies have revealed a novel interplay between Chk1 kinase and Cdc14B phosphatase involving radiation-induced nucleolar shuttling to facilitate error-free cell cycle progression and prevent genomic instability
21212274 TAp73 induction by nitric oxide: regulation by checkpoint kinase 1 (CHK1) and protection against apoptosis.
21179472 analysis of a pathway through which Chk1 inhibition can mediate HDACi-induced mitotic entry and cell death
21173116 At low levels of replication stress, ATR/Chk1 suppresses origin initiation by inhibiting the activation of new replication factories (RF), thereby reducing the number of active RF, but allowing dormant origins to initiate within existing RF.
21171266 Chk1 is expressed in human sperm, but differently in different semen quality groups; expression is correlated with sperm DNA damage and apoptosis.
21154811 our data suggest that inactivation of EI24 and CHEK1 through two independent mechanisms contributes to the development of CACX.
21118956 In response to ultraviolet radiation, Lats2 is phosphorylated by Chk1 and Chk2 at S408.
21051833 The positive rates of CHK1 were significantly higher in gastric cancer than that in different types of benign lesions.
21034966 ATM-Chk2 and ATR-Chk1 pathways have roles in DNA damage signaling and cancer [review]
20805465 Chk1 promotes replication fork progression during normal S phase by controlling replication origin activity
20731661 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20719863 Chk1-mediated phosphorylation on BLM at Ser(646) might be a determinant for regulating subnuclear localization and could act as a marker for the activation status of BLM in response to DNA damage.
20716119 Data suggest that recovery from oxidative DNA damage-induced G(2) arrest requires Chk1.
20644561 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20639859 14-3-3gamma mediates the interaction between Chk1 and Cdc25A; this ternary complex formation has an essential function in Cdc25A phosphorylation and degradation to block premature mitotic entry after DNA damage.
20616048 describe an in vitro checkpoint system in which replication protein A-single-stranded DNA and TopBP1 are essential for phosphorylation of Chk1 by the purified ATR-ATR-interacting protein complex.
20609246 HIV-1 Vpr activates ATR, resulting in phosphorylation of Chk1 and activation of the ATR-mediated DNA damage response
20599444 Data show that Chk1 activation as a key factor to mediate TK/GCV cytotoxicity.
20581453 Inhibition of plk1 through dephosphorylation was dependent on AtM/Chk1 activity
20567916 Genomic rearrangements of the CHK1 gene is associated with breast cancer.
20567916 Observational study of gene-disease association. (HuGE Navigator)
20514472 ATM and Chk1/2-mediated phosphorylation of cdc25C plays a major role in cell cycle arrest induced by pectenotoxin 2.
20508983 Observational study of gene-disease association. (HuGE Navigator)
20496165 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20495005 Akt prevents the translocation of BRCA1 to DNA damage foci and, thereby, inhibits the activation of Chk1 following DNA damage
20453000 Observational study of gene-disease association. (HuGE Navigator)
20233725 RPA-covered ssDNA not only supports recruitment and activation of ATR but also, through Tipin and Claspin, it plays an important role in the action of ATR on its critical downstream target Chk1
20159774 The DNA damage-activated kinases Chk1 and Chk2 may be involved in tau phosphorylation and toxicity in the pathogenesis of Alzheimer's disease.
20146081 This study suggests a possible role for Chk1 in the differentiation program of umbilical cord blood CD133+ hematopoietic stem cells.
20123862 In the absence of DNA polymerase eta, Chk1 kinase becomes essential for replication resumption by alternative pathways, via fork stabilization.
20090422 NEK11 controls degradation of CDC25A by directly phosphorylating CDC25A on residues whose phosphorylation is required for beta-TrCP mediated CDC25A polyubiquitylation and degradation.
20068082 New insights into the role of Chk1 in the DNA damage response machinery could provide an opportunity for novel approaches to the development of Chk1 inhibitor strategies.
20053681 gammaH2AX foci in Chk1-depleted cells may represent sites of persistent replication fork damage or abandonment that are unable to resume DNA synthesis but do not play a direct role in the Chk1 suppressed death pathway
20029092 proliferating cell nuclear antigen, ATR, TopBP1, and Chk1 are recruited to chromatin in a MutLalpha- and MutSalpha-dependent fashion after N-methyl-N'-nitro-N-nitrosoguanidine treatment.
19931269 Fhit is significantly directly correlated with absence of activated Chk1 in dysplasia, suggesting a connection between loss of Fhit and modulation of checkpoint activity.
19903823 Abrogation of G(2) arrest by inhibition of ATM and ATR, Chk1, and Wee1 suppressed JCV genome replication.
19861535 phosphorylation of S331 of FANCD2 is mediated by CHK1
19843865 antagonizing CHK1 kinase strongly reduces the clonogenic properties of high-DNA damage level acute myeloid leukemia samples
19838212 Chk1 signalling causes centrosome amplification after ionizing radiation by upregulating Cdk2 activity through activating phosphorylation.
19837665 Chk1 phosphorylation by Cdk1 participates in cytoplasmic sequestration of Chk1 activity, which releases Cdk1 inhibition in the nucleus and promotes mitotic entry
19828454 Data show that the ATR-dependent phosphorylation of Chk1, but not p53, is strongly stimulated by Claspin.
19778378 U2OS cells lacking Chk1 undergo abnormal mitosis and fail to activate the spindle checkpoint, suggesting a role of Chk1 in this checkpoint.
19743875 Cocrystal structures of the inhibitors bound to CHK1 reveal an allosteric site, unique to CHK1, located in the C-terminal domain and consisting of a shallow groove linked to a small hydrophobic pocket.
19716789 Fbx6-dependent Chk1 degradation contributes to S phase checkpoint termination and that a defect in this mechanism might increase tumor cell resistance to certain anticancer drugs.
19714462 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19694479 Studied vertebrate cells with compromised Chk1 function; only one protein, the histone chaperone nucelophosmin, was altered consistently in line with changes in chromatin-associated Chk1 and increased in response to DNA damage.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19690177 Observational study of gene-disease association. (HuGE Navigator)
19628579 XAF1 as a novel cell cycle regulator through modulating G(2)/M checkpoint and interaction with checkpoint kinase 1 in gastrointestinal cancer.
19625176 Observational study of gene-disease association. (HuGE Navigator)
19615254 Down-regulating Chk1 and Chk2 may increase the apoptotic sensitivity to irradiation due to changes of the pattern of cell cycle specific apoptosis.
19584159 Data show that Chk1 inhibitor PF-00477736 offers a therapeutic potential for the enhancement of taxane therapy.
19570909 Data show that disruption of ATR and Chk1 in mismatch repair-deficient cells increased the number of chromosomal abnormalities and enhanced the sensitivity to treatment with 5-fluorouracil.
19546241 Results show that a lack of microcephalin or pericentrin results in a loss of Chk1 from centrosomes with subsequently deregulated activation of centrosomal cyclin B-Cdk1.
19487575 ablation of the protein kinase Chk1 rescues the p21 transcription elongation defect when cells are blocked in S phase
19477924 Cdh1 reciprocally regulates the Rb pathway through competing with E2F1 to bind the hypophosphorylated form of Rb.
19473886 The structure, regulation, and functions of Chk1 and Chk2 in the DNA damage response, as well as their potential roles in human disease, is discussed.
19453842 Suppression of the Chk1/Chk2 protein by shRNA constructs inhibited the growth of oral pulp cells, which indicates that these checkpoint proteins may be essential for normal cell growth.
19401701 Critical role of ATM/Chk1 in curcumin-mediated G2/M cell cycle arrest and apoptosis in pancreatic cancer cells.
19276361 Chk1 abundance is regulated by the Cul4A/DDB1 ubiquitin ligase during an unperturbed cell division cycle, in response to replicative stress and on heat shock protein 90 inhibition.
19275579 HIV-1 Vpr activates ATR, resulting in phosphorylation of Chk1 and activation of the ATR-mediated DNA damage response
19270516 Chk1 regulates origin firing predominantly by controlling Cdk2-Cdc25 function.
19242509 relevant target of caffeine is the ATR-Chk1 pathway and that inhibiting ATR or Chk1 might have promise in preventing or reversing UV damage
19177015 Results show that depletion of DNA polymerase alpha and not Polepsilon or Poldelta by siRNA induces phosphorylation of Chk1 on Ser345, thus phenocopying antimetabolite exposure.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19124506 Observational study of gene-disease association. (HuGE Navigator)
19119425 ATR-Chk1 signalling pathway plays a major role in the regulation of death in response to DNA replication stress and that the Chk1-suppressed pathway protecting cells from replication stress is clearly distinguishable from that protecting cells from IR
19091954 Essential function of Chk1 can be uncoupled from DNA damage checkpoint and replication control
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19064565 Observational study of gene-disease association. (HuGE Navigator)
19060337 Chk1 affects Cdc25A via rapid phosphorylation and protein turnover, inhibition of Cdc25A transcription by p53-ATF3 is required for the maintenance of cell cycle arrest.
18983824 Chk1-Ser286 and -Ser301 phosphorylation occurs not only in mitosis but also with stalled DNA replication and stimulation of the damage checkpoint.
18950845 Observational study of gene-disease association. (HuGE Navigator)
18820127 HSP90 inhibition abrogates the topoisomerase I poison-induced G2/M checkpoint in p53-null tumor cells by depleting CHK1 and WEE1.
18723495 Chk1 is phosphorylated at Ser(317) by ATR resulting in stabilization of CKII, which in turn leads to phosphorylation of PTEN at Thr(383)
18698031 Chk1 protein is a molecular target to be inhibited in tumors with a defective G1 checkpoint to increase the selectivity of anticancer treatments.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18671143 Cyclin B1 is an efficacy-predicting biomarker for antineoplastic Chk1 inhibitors.
18642443 study demonstrates that Chk1 inhibition results in the activating phosphorylation of p38 mitogen-activated protein kinase
18632613 the inhibition of the stress response sensor CHEK1 might contribute to the antineoplastic activity of specific DNA-damaging drugs
18566216 These findings systematically dissect the differential roles of Chk1 and Chk2 in a favorable model pursuing camptothecin-driven DNA damage responses.
18550533 Chk1 is activated by caspase-mediated cleavage during apoptosis and might be implicated in enhancing apoptotic reactions rather than attenuating the ATR-Chk1 pathway
18495871 Mcl-1, perhaps acting as an adaptor protein, in controlling the ATR-mediated regulation of Chk1 phosphorylation
18480045 Chk1 is the primary signal transducer linking activation of the ATM/ATR kinases to Cdc25A destruction in response to ionizing radiation.
18469532 Chk1, but neither Chk2 nor MK2, is an important regulator of S phase arrest, and suggest that an additional kinase can contribute to the G(2) arrest.
18451105 Data show that Chk1 and the Claspin-Timeless module of replication forks not only participate in ATR signaling, but also protect stressed forks independently of ATR.
18448427 a conserved proliferating cell nuclear antigen-interacting protein sequence in Chk1 is required for checkpoint function
18434539 p53 is activated by stimulation of mismatch repair in response to the misincorporation of deoxynucleotides into newly synthesized DNA, long before the lack of pyrimidine nucleoside triphosphates causes the rate of DNA synthesis to slow appreciably.
18424430 Chk1 appears to help defend genomic integrity through effects on several other pathways, including Fanconi anemia proteins, the mitotic spindle, and transcription of cell cycle-related genes [review]
18381943 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18346918 findings show that BCL6 can directly bind to a DNA consensus element in the CHEK1 promoter and repress its expression in normal and malignant B-cells
18339864 Hsp72-depleted cells show defect in phosphorylation and activation of the protein kinase Chk1 by genotoxic stresses, such as UVC irradiation or camptothecin.
18331829 These results demonstrate that phosphorylation of Claspin within the Chk1-binding domain is catalysed by an ATR-dependent kinase distinct from Chk1.
18317453 Chk1 and Chk2 regulate the functional associations between hBRCA2 and Rad51 in response to DNA damage
18270339 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18247328 CHK1 was at least partially responsible for the lithium arrested hepatocellular carcinoma cell SMMC-7721 at G2/M checkpoint
18243098 CHK1 is a histone H3 threonine 11 kinase that requires DNA damage-induced transcriptional repression.
18239674 Results suggest that apoptosis induced by replication inhibitors in Chk1-depleted cells is dependent upon the helicase cofactor Cdc45.
18229454 A side-by-side comparison of the Hsp90-dependent chaperoning of Chk1 to that of the progesterone receptor (PR) was performed to show that these distinct types of clients have different chaperoning requirements.
18159231 Chk1 inhibition activated p53-regulated transcripts including Puma/BBC3 in tetraploid but not in diploid tumor cells
18088187 suggests the unique role of Chk1 in preventing abrogation of the G2 checkpoint in p53+/+ cells
18071310 Abrogation of G2 checkpoint by Geldanamycin may play a central role in sensitizing p53-negative tumor cells to DNA-damaging and decatenation-inhibiting agents.
18029388 Loss of CHK1 function impedes DNA damage-induced FANCD2 monoubiquitination but normalizes the abnormal G2 arrest in Fanconi anemia.
17986860 This review of new findings demonstrates that DNA replication fork velocity (fork progression) is coordinated with inter-origin distance and that it can be actively slowed down by Chk1-dependent mechanisms in response to DNA damage.
17912454 protein kinase CK2 is involved in cell cycle regulation and indicate the mechanism by which CDC25A turnover might be regulated by Chk1 in the absence of DNA damage.
17879369 Observational study of gene-disease association. (HuGE Navigator)
17879369 Frequent mutations in CHEK1(5%) damage response axis in colon cancers.
17726372 Centrosomal Chk1 induces G2/M cell cycle arrest and may evoke centrosome amplification, the latter possibly providing a backup mechanism for elimination of cells with impaired DNA damage checkpoints operating earlier during the cell cycle
17716975 ATR/Chk1 pathway is activated at an early time point after the loss of Geminin and contributes to checkpoint arrest
17684142 Observational study of gene-disease association. (HuGE Navigator)
17638866 Chk1 is E2F regulated and highly expressed in triple-negative estrogen receptor /progesterone receptor /HER-2 breast carcinomas
17611684 zoledronate induces DNA damage and S phase arrest, accompanied by activation of the ATM/Chk1/cdc25 pathway in a human osteosarcoma cell line
17544403 Phosphorylation of p53 (Ser15), Chk1 (Ser345), and Chk2 (Thr68) was also observed, suggesting that H/R activates p53 through checkpoint signals.
17491592 Chk1 regulates the density of active replication origins during the vertebrate S phase.
17468739 Inhibition of checkpoint kinase 1 (Chk1) by RNA-mediated interference or drug treatment suppressed DNA-damage-induced centrosome amplification.
17464182 Novel substrates for Chk1 and Chk2 were screened using substrate target motifs determined previously by an oriented peptide library approach.
17408908 Observational study of gene-disease association. (HuGE Navigator)
17408908 the Chk1 framshift mutations might be involved in colorectal tumourigenesis through a defect in response to DNA damage in a subset of sporadic colorectal cancers and HNPCCs.
17296736 Chk1-mediated phosphorylation of FANCE is required for a function independent of FANCD2 monoubiquitination.
17276342 These results suggest a mechanism through which Chk1 could protect against tumorigenesis through its role in spindle checkpoint signaling.
17274954 Interfering with PCNA function by overexpression of p21 mutant, impaired in its interaction with Cdks but not with PCNA, leads to ATR-dependent Chk1 activation.
17210576 HIV-1 Vpr activates ATR, resulting in phosphorylation of Chk1 and activation of the ATR-mediated DNA damage response
17106257 Chk1 functions to coordinate mitotic events through regulation of Cdc25B
17102638 Plk1 has a role in mitotic arrest, which is released by Chk1
17015476 ataxia-telangiectasia-related protein kinase-Chk1-protein phosphatase 2A regulatory circuit functions to keep Chk1 in a low-activity state during an unperturbed cell division cycle
17003105 Results show under normal cell cycle conditions and in the absence of DNA damage, CHK1 constitutively phosphorylates CDC25B during interphase and thus prevents the premature initiation of mitosis.
16951182 Chk1 can be activated in a claspin-dependent manner leading to cyclin B1 down-regulation and providing the cells of an additional mechanism to inhibit mitosis entry in Hela cells.
16927022 Either chk1 or plk1-specific antisense oligodeoxynucleotides enhanced DNA damaging agent-induced apoptosis.
16912045 the Chk1-mediated S-phase checkpoint targets initiation factor Cdc45 via a Cdc25A/Cdk2-independent mechanism
16885021 Data suggest that degradation of Claspin by SCFbetaTrCP restrains Chk1 activation.
16880517 These results suggest that while TopBP1 is a general regulator of ATR, Claspin operates downstream of TopBP1 to selectively regulate the Chk1-controlled branch of the genotoxic stress response.
16873548 Checkpoint kinase 1 (Chk1) is required for mitotic progression through negative regulation of polo-like kinase 1 (Plk1)
16828751 the Chk1 pathway is regulated through both phosphorylation of Claspin and its controlled degradation.
16732333 Critical role in regulating chromosome stability, and in particular, common fragile site stability.
16652144 Inhibition of Chk1 by an RNAi approach resulted in an increase in cell death in p53-null cells, showing that the Chk1-dependent G(2) checkpoint protected cells that lacked a functional p53 pathway from oxidative stress
16649252 Chk1-mediated G(2)/M cell-cycle arrest by the histamine H1 antagonist, loratidine in a tumor cell line.
16629900 These observations imply the regulation of mitotic Chk1 function through Chk1 phosphorylation at novel sites by Cdk1.
16619043 Chk1-dependent replication checkpoint which slows S phase progression can protect tumour cells against the cytotoxic effects of 5FU.
16581803 CHK1 maintains global replication fork stability in response to DNA damage amd DNA replication inhibitors.
16501606 Chk1 and Claspin proteins regulate each other and thus ensure the proper cell cycle progression and replication checkpoint control.
16414312 Gene repair directed by oligonucleotides activates a pathway that prevents corrected cells from proliferating in cell culture through the activation of Chk1 and Chk2.
16330544 Chk1 is post-translationally chaperoned to an active kinase. This reaction minimally requires Hsp90, Hsp70, Hsp40, Cdc37, and the protein kinase CK2.
16306615 HIV-1 Vpr activates ATR, resulting in phosphorylation of Chk1 and activation of the ATR-mediated DNA damage response
16280359 Chk1 plays a primary role in the protection of cells from death induced by replication fork stress, whereas p21 mediates through its role in regulating entry into S phase
16217032 Data suggest that the microcephaly observed in patients with MCPH1 deficiencies is due to disruption of the ATR-BRCA1-Chk1 signaling pathway that is also disrupted in Seckel syndrome patients.
16159883 Chk1 deficiency resulted in a premature onset of mitosis because of abnormal activation of cyclin B-Cdc2 and led to the activation of caspases 3 and 9 triggered by cytoplasmic release of cytochrome c.
16123041 cleavage of Claspin by caspase-7 inactivates the Chk1 signaling pathway
15974586 Synthetized inhibitors are synthetically tractable and inhibit Chk1 by competing for its ATP site.
15961392 results of the present study suggest existence of a checkpoint kinase 1-dependent mechanism for diallyl trisulfide-induced mitotic arrest in human prostate cancer cells
15831461 Chk1 is required during normal S phase to avoid aberrantly increased initiation of DNA replication, thereby protecting against DNA breakage.
15743907 ATR phosphorylates Chk1 in cells expressing only a mutant of ATRIP that does not bind to RPA-ssDNA.
15710331 loss of PTEN and subsequent activation of AKT impair CHK1 through phosphorylation, ubiquitination, and reduced nuclear localization to promote genomic instability in tumor cells
15705874 Expression of Chk1 blunted induction of gammaH2AX foci by Cdk inhibitors, indicating that Chk1 down-regulation was necessary to elicit the full phenotype.
15699047 Results show that the ATR/checkpoint kinase 1 pathway plays a predominant role in the response to topoisomerase I inhibitors in carcinoma cells.
15688426 Chk1 downregulation can not only potentiate DNA-damaging agents, but also enhance the toxicity of anti-microtubule agents.
15659650 possible interplay between tumor protein p53 C-terminal phosphorylation and acetylation, and they provide an additional mechanism for the control of the activity of p53 by Checkpoint kinase 1 and Checkpoint kinase 2
15655357 results indicate that the different radiosensitivities & G(2)checkpoint responses are independent of NHEJ, suggesting that CHK1-regulated checkpoint facilitates homologous recombination repair & protects cells from ionizing radiation-induced killing
15647386 Chk1 and Chk2 have roles in mismatch repair-dependent G2 arrest
15601819 Chk1 and Chk2 control the induction of the p53 related transcription factor p73 in response to DNA damage.
15539958 role of Chk1 in maintaining tumor cell viability following activation of the replication checkpoint
15526025 CHK1 inactivation in non-hodgkin's lymphoma occurs by loss of protein expression in a subset of aggressive variants alternatively to ATM, CHK2, and p53 alterations
15326376 These data further emphasise the role of Chk1 as a molecular target to inhibit in tumors with a defect in the G(1) checkpoint with the aim of increasing the selectivity and specificity of anticancer drug treatments.
15311285 results suggest that centrosome-associated Chk1 shields centrosomal Cdk1 from unscheduled activation by cytoplasmic Cdc25B, thereby contributing to proper timing of the initial steps of cell division, including mitotic spindle formation.
15279790 the Chk1 pathway involves claspin, which functions in checkpoint control [review]
15225637 Formation of a stable complex between protein kinase CK2beta and Chk1 is not affected by the modification of Thr213 but it does require the presence of an active Chk1 kinase.
15220350 Brca1 and Chk1 are regulated by MCPH1 during DNA damage in tumor cell lines
14988723 The transient slow-down of DNA synthesis was abolished in cells lacking ATR, whereas CHK1-siRNA-treated cells, NBS1 or Fanconi anemia cells showed partial S-phase arrest.
14759516 CHEK1 interacts with XIAP protein during mitosis.
14681223 data reveal the very different mode of regulation between CHK1 and CHK2
14570880 Chk1 is a novel Hsp90 client with a role in sensitization of tumor cells to replication stress
14559997 Data suggest that the Chk1/Cdc25A/14-3-3 pathway functions to prevent cells from entering into mitosis prior to replicating their genomes to ensure the fidelity of the cell division process.
14504477 Data report the isolation and characterization of the 5' flanking region of the Chk1 gene, and show that this region has promoter activity.
12959929 hyperoxia activates the ATR-Chk1 pathway and phosphorylates p53 at multiple sites in an ATM-independent manner, which is different from other forms of oxidative stress such as H2O2 or UV light.
12955071 we show that Chk1 is essential for the suppression of TLK activity after replication block, but that ATR, Chk2 and BRCA1 are dispensable for TLK suppression.
12813133 Chk1 expression is dispensable for somatic cell death and critical for sustaining G2 DNA damage checkpoint
12791699 the G2 checkpoint in irradiated human cells derives from an overactivation of the ATR/CHK1 pathway.
12756247 Chk1 protein complexes bind to single-stranded DNA and DNA ends and has a role in the repair of double strand breaks
12738771 HIV-1 Vpr activates ATR, resulting in phosphorylation of Chk1 and activation of the ATR-mediated DNA damage response
12676925 Chk1 mediates both S and G2 checkpoint and is thus a more ubiquitous cell cycle checkpoint mediator than previously thought
12676583 CHK1 regulates the S phase checkpoint by coupling the physiological turnover and ionizing radiation-induced accelerated proteolysis of Cdc25A.
12660173 targets tousled like kinasese via DNA damage checkpoint
12588868 Chk1 is phosphorylated by ATM and NBS1 and is essential for ionizing radiation-induced inhibition of DNA synthesis and the G(2)/M checkpoint
12446774 Data suggest that the UVC-induced S checkpoint response of inhibition of replicon initiation is mediated by ATR signaling through Chk-1 and is independent of ATM, Nbs1, and Mre11.
12399544 findings indicate that Chk1 directly phosphorylates Cdc25A during an unperturbed cell cycle, and that phosphorylation of Cdc25A by Chk1 is required for cells to delay cell cycle progression in response to double-strand DNA breaks
12150968 role in mediating G(2)M checkpoint in relation to the cellular resistance to the novel topoisomerase I poison BNP1350
11912127 An ATM-independent S-phase checkpoint response involves CHK1 pathway.
11896572 radiation induced phosphotylation of chK1 is associated with p53-dependent cell cycle arrest pathways in tumor
11821419 utilization of peptide library analyses to develop specific, highly preferred substrate motifs for hCds1/Chk2 and Chk1
9278511 Biochemical studies suggest the functional interactions of this protein with cell cycle regulators. Cdc25A, Cdc25B, and Cdc25C can be phosphoryalted by this protein.

AA Sequence

MAVPFVEDWDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMKRAVDCPENIKKEICINKMLNHENVVKF      1 - 70
YGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEPDAQRFFHQLMAGVVYLHGIGITHRDIKPENLLLDE     71 - 140
RDNLKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLKRREFHAEPVDVWSCGIVLTAMLAGELPWDQ    141 - 210
PSDSCQEYSDWKEKKTYLNPWKKIDSAPLALLHKILVENPSARITIPDIKKDRWYNKPLKKGAKRPRVTS    211 - 280
GGVSESPSGFSKHIQSNLDFSPVNSASSEENVKYSSSQPEPRTGLSLWDTSPSYIDKLVQGISFSQPTCP    281 - 350
DHMLLNSQLLGTPGSSQNPWQRLVKRMTRFFTKLDADKSYQCLKETCEKLGYQWKKSCMNQVTISTTDRR    351 - 420
NNKLIFKVNLLEMDDKILVDFRLSKGDGLEFKRHFLKIKGKLIDIVSSQKIWLPAT                  421 - 476
//

Text Mined References (387)

PMID Year Title
27129240 2016 Conformational Change of Human Checkpoint Kinase 1 (Chk1) Induced by DNA Damage.
26921499 2016 ATR-CHK1-E2F3 signaling transactivates human ribonucleotide reductase small subunit M2 for DNA repair induced by the chemical carcinogen MNNG.
26810087 2016 Apoptosis and failure of checkpoint kinase 1 activation in human induced pluripotent stem cells under replication stress.
26804904 2016 Signaling from Mus81-Eme2-Dependent DNA Damage Elicited by Chk1 Deficiency Modulates Replication Fork Speed and Origin Usage.
26748709 2016 Cancer-Specific Synthetic Lethality between ATR and CHK1 Kinase Activities.
26693937 2016 Tetraploid cells produced by absence of substrate adhesion during cytokinesis are limited in their proliferation and enter senescence after DNA replication.
26667770 2015 Regulation of ATRIP protein abundance by RAD9 in the DNA damage repair pathway.
26658951 2015 Chk1 Activation Protects Rad9A from Degradation as Part of a Positive Feedback Loop during Checkpoint Signalling.
26542114 2015 In vitro and in vivo single-agent efficacy of checkpoint kinase inhibition in acute lymphoblastic leukemia.
26459098 2016 Chk1 phosphorylated at serine345 is a predictor of early local recurrence and radio-resistance in breast cancer.
26439697 2015 Characterization of a mantle cell lymphoma cell line resistant to the Chk1 inhibitor PF-00477736.
26365377 2015 Distinct but Concerted Roles of ATR, DNA-PK, and Chk1 in Countering Replication Stress during S Phase.
26296656 2015 hHR23A is required to control the basal turnover of Chk1.
26141863 2015 CHK1 Inhibition Synergizes with Gemcitabine Initially by Destabilizing the DNA Replication Apparatus.
26061604 2015 Mangrove dolabrane-type of diterpenes tagalsins suppresses tumor growth via ROS-mediated apoptosis and ATM/ATR-Chk1/Chk2-regulated cell cycle arrest.
26039276 2015 KA1-targeted regulatory domain mutations activate Chk1 in the absence of DNA damage.
26025928 2015 Pharmacological inactivation of CHK1 and WEE1 induces mitotic catastrophe in nasopharyngeal carcinoma cells.
25966274 2015 Mangiferin induces cell cycle arrest at G2/M phase through ATR-Chk1 pathway in HL-60 leukemia cells.
25904336 2015 ATR and a Chk1-Aurora B pathway coordinate postmitotic genome surveillance with cytokinetic abscission.
25884494 2015 Topotecan synergizes with CHEK1 (CHK1) inhibitor to induce apoptosis in ovarian cancer cells.
25840419 2015 MiR-195 suppresses non-small cell lung cancer by targeting CHEK1.
25809478 2015 Phosphorylation of Minichromosome Maintenance 3 (MCM3) by Checkpoint Kinase 1 (Chk1) Negatively Regulates DNA Replication and Checkpoint Activation.
25795119 The fork and the kinase: a DNA replication tale from a CHK1 perspective.
25757065 2015 Aven-mediated checkpoint kinase control regulates proliferation and resistance to chemotherapy in conventional osteosarcoma.
25690891 2015 CHK1-driven histone H3.3 serine 31 phosphorylation is important for chromatin maintenance and cell survival in human ALT cancer cells.
25688741 2015 Checkpoint kinase1 (CHK1) is an important biomarker in breast cancer having a role in chemotherapy response.
25653093 2015 Suppression of CHK1 by ETS Family Members Promotes DNA Damage Response Bypass and Tumorigenesis.
25557548 2015 Interaction of Chk1 with Treslin negatively regulates the initiation of chromosomal DNA replication.
25483185 2014 Induction of mitotic catastrophe by PKC inhibition in Nf1-deficient cells.
25483076 2014 Checkpoint kinase 2 is required for efficient immunoglobulin diversification.
25474241 2014 Loss of compensatory pro-survival and anti-apoptotic modulator, IKK?, sensitizes ovarian cancer cells to CHEK1 loss through an increased level of p21.
25468710 2015 Untangling the ATR-CHEK1 network for prognostication, prediction and therapeutic target validation in breast cancer.
25460505 2015 DNA damage-induced S and G2/M cell cycle arrest requires mTORC2-dependent regulation of Chk1.
25459351 2015 Development of pharmacodynamic biomarkers for ATR inhibitors.
25444911 2015 UNC45A localizes to centrosomes and regulates cancer cell proliferation through ChK1 activation.
25428911 2015 Combined inhibition of Chk1 and Wee1 as a new therapeutic strategy for mantle cell lymphoma.
25375241 2014 A functional approach reveals a genetic and physical interaction between ribonucleotide reductase and CHK1 in mammalian cells.
25336189 2014 Identification of ATR-Chk1 pathway inhibitors that selectively target p53-deficient cells without directly suppressing ATR catalytic activity.
25312395 2014 Identification of novel inhibitors of human Chk1 using pharmacophore-based virtual screening and their evaluation as potential anti-cancer agents.
25249323 2014 ATR/Chk1/Smurf1 pathway determines cell fate after DNA damage by controlling RhoB abundance.
25208576 2014 Human Tra2 proteins jointly control a CHEK1 splicing switch among alternative and constitutive target exons.
25132270 2015 CHK1 overexpression in T-cell acute lymphoblastic leukemia is essential for proliferation and survival by preventing excessive replication stress.
25086746 2014 ATM-mediated stabilization of ZEB1 promotes DNA damage response and radioresistance through CHK1.
25084614 2014 CHK1 plays a critical role in the anti-leukemic activity of the wee1 inhibitor MK-1775 in acute myeloid leukemia cells.
25049228 2014 The interaction between checkpoint kinase 1 (Chk1) and the minichromosome maintenance (MCM) complex is required for DNA damage-induced Chk1 phosphorylation.
25015292 2014 Chk1 protects against chromatin bridges by constitutively phosphorylating BLM serine 502 to inhibit BLM degradation.
25012639 2014 Chk1 activity is required for BAK multimerization in association with PUMA during mitochondrial apoptosis.
24971465 2014 Chk1-induced CCNB1 overexpression promotes cell proliferation and tumor growth in human colorectal cancer.
24923443 2014 Ubiquitin-specific peptidase 20 regulates Rad17 stability, checkpoint kinase 1 phosphorylation and DNA repair by homologous recombination.
24913641 2014 Inhibition of the checkpoint kinase Chk1 induces DNA damage and cell death in human Leukemia and Lymphoma cells.
24894074 2014 Effects of Chk1 inhibition on the temporal duration of radiation-induced G2 arrest in HeLa cells.
24853623 2014 Co-abrogation of Chk1 and Chk2 by potent oncolytic adenovirus potentiates the antitumor efficacy of cisplatin or irradiation.
24853431 2014 DNA replication stress in CHK1-depleted tumour cells triggers premature (S-phase) mitosis through inappropriate activation of Aurora kinase B.
24823293 2014 Inhibition of autophagy enhances DNA damage-induced apoptosis by disrupting CHK1-dependent S phase arrest.
24810059 2014 Combined PDK1 and CHK1 inhibition is required to kill glioblastoma stem-like cells in vitro and in vivo.
24762558 2014 Fos-dependent induction of Chk1 protects osteoblasts from replication stress.
24747134 2014 Chk1 is required for the metaphase-anaphase transition via regulating the expression and localization of Cdc20 and Mad2.
24650757 2014 Chk1, but not Chk2, is responsible for G2/M phase arrest induced by diallyl disulfide in human gastric cancer BGC823 cells.
24639502 2014 STAT3 interrupts ATR-Chk1 signaling to allow oncovirus-mediated cell proliferation.
24636978 2014 Chk1 as a new therapeutic target in triple-negative breast cancer.
24634213 2014 Src family kinases promote silencing of ATR-Chk1 signaling in termination of DNA damage checkpoint.
24464213 2014 Checkpoint kinase 1 is negatively regulated by miR-497 in hepatocellular carcinoma.
24441772 2014 NSC746364, a G-quadruplex-stabilizing agent, suppresses cell growth of A549 human lung cancer cells through activation of the ATR/Chk1-dependent pathway.
24336073 2013 miR-16 and miR-26a target checkpoint kinases Wee1 and Chk1 in response to p53 activation by genotoxic stress.
24327542 2014 Targeted inhibition of ATR or CHEK1 reverses radioresistance in oral squamous cell carcinoma cells with distal chromosome arm 11q loss.
24244429 2013 Panobinostat enhances cytarabine and daunorubicin sensitivities in AML cells through suppressing the expression of BRCA1, CHK1, and Rad51.
24197116 2014 Mitotic arrest by tumor suppressor RASSF1A is regulated via CHK1 phosphorylation.
24158981 2014 A bioinformatics approach identifies signal transducer and activator of transcription-3 and checkpoint kinase 1 as upstream regulators of kidney injury molecule-1 after kidney injury.
24117075 2013 Wedelia chinensis inhibits nasopharyngeal carcinoma CNE-1 cell growth by inducing G2/M arrest in a Chk1-dependent pathway.
24113549 2013 CHK1 levels correlate with sensitization to pemetrexed by CHK1 inhibitors in non-small cell lung cancer cells.
24098799 2013 Panobinostat synergistically enhances the cytotoxic effects of cisplatin, doxorubicin or etoposide on high-risk neuroblastoma cells.
24002546 2013 Dihydromyricetin suppresses the proliferation of hepatocellular carcinoma cells by inducing G2/M arrest through the Chk1/Chk2/Cdc25C pathway.
23954429 2013 Chk1 inhibits E2F6 repressor function in response to replication stress to maintain cell-cycle transcription.
23932155 2013 HPV-positive HNSCC cell lines but not primary human fibroblasts are radiosensitized by the inhibition of Chk1.
23844225 2013 Associations of ATR and CHEK1 single nucleotide polymorphisms with breast cancer.
23799366 2013 DNA polymerase ?-dependent DNA synthesis at stalled replication forks is important for CHK1 activation.
23798705 2013 Centrosomal Che-1 protein is involved in the regulation of mitosis and DNA damage response by mediating pericentrin (PCNT)-dependent Chk1 protein localization.
23748345 2014 Pim kinases phosphorylate Chk1 and regulate its functions in acute myeloid leukemia.
23733185 2013 4-Hydroxynonenal induces G2/M phase cell cycle arrest by activation of the ataxia telangiectasia mutated and Rad3-related protein (ATR)/checkpoint kinase 1 (Chk1) signaling pathway.
23720738 2013 Phosphorylation of minichromosome maintenance protein 7 (MCM7) by cyclin/cyclin-dependent kinase affects its function in cell cycle regulation.
23600770 2013 HY-1 induces G(2)/M cell cycle arrest in human colon cancer cells through the ATR-Chk1-Cdc25C and Weel pathways.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23536721 2013 The novel Chk1 inhibitor MK-8776 sensitizes human leukemia cells to HDAC inhibitors by targeting the intra-S checkpoint and DNA replication and repair.
23533280 2013 Candidate tumor suppressor BTG3 maintains genomic stability by promoting Lys63-linked ubiquitination and activation of the checkpoint kinase CHK1.
23454898 2013 Chk1-Mad2 interaction: a crosslink between the DNA damage checkpoint and the mitotic spindle checkpoint.
23447702 2013 The nucleolus stress response is coupled to an ATR-Chk1-mediated G2 arrest.
23447674 2013 UV-induced G2 checkpoint depends on p38 MAPK and minimal activation of ATR-Chk1 pathway.
23383610 2013 Identification of ovarian cancer associated genes using an integrated approach in a Boolean framework.
23321637 2013 Chk1 and Mps1 jointly regulate correction of merotelic kinetochore attachments.
23269272 2013 MYC regulation of CHK1 and CHK2 promotes radioresistance in a stem cell-like population of nasopharyngeal carcinoma cells.
23255133 2013 Separation of intra-S checkpoint protein contributions to DNA replication fork protection and genomic stability in normal human fibroblasts.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23109433 2013 CRL4(CDT2) targets CHK1 for PCNA-independent destruction.
23085068 2013 CHK1 cleavage in programmed cell death is intricately regulated by both caspase and non-caspase family proteases.
23068608 2012 DNA damage-induced CHK1 autophosphorylation at Ser296 is regulated by an intramolecular mechanism.
22942255 2012 Cisplatin sensitivity mediated by WEE1 and CHK1 is mediated by miR-155 and the miR-15 family.
22939624 2012 Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition.
22863316 2012 A DNA-damage selective role for BRCA1 E3 ligase in claspin ubiquitylation, CHK1 activation, and DNA repair.
22855742 2012 Autoregulatory mechanisms of phosphorylation of checkpoint kinase 1.
22743332 2012 BRCA1-dependent Chk1 phosphorylation triggers partial chromatin disassociation of phosphorylated Chk1 and facilitates S-phase cell cycle arrest.
22692200 2012 Coupling cellular localization and function of checkpoint kinase 1 (Chk1) in checkpoints and cell viability.
22621920 2012 ATP depletion triggers acute myeloid leukemia differentiation through an ATR/Chk1 protein-dependent and p53 protein-independent pathway.
22585575 2012 CHK1 targets spleen tyrosine kinase (L) for proteolysis in hepatocellular carcinoma.
22556425 2012 Hypoxia activates tumor suppressor p53 by inducing ATR-Chk1 kinase cascade-mediated phosphorylation and consequent 14-3-3? inactivation of MDMX protein.
22553144 2012 Human embryonic stem cells fail to activate CHK1 and commit to apoptosis in response to DNA replication stress.
22529391 2012 Kinase-independent function of checkpoint kinase 1 (Chk1) in the replication of damaged DNA.
22505024 2012 Chk1 phosphorylates the tumour suppressor Mig-6, regulating the activation of EGF signalling.
22469983 2013 Suppressed miR-424 expression via upregulation of target gene Chk1 contributes to the progression of cervical cancer.
22435685 2012 Novel regulation of checkpoint kinase 1: Is checkpoint kinase 1 a good candidate for anti-cancer therapy?
22433954 2012 Chk1 suppresses bypass of mitosis and tetraploidization in p53-deficient cancer cells.
22401965 2012 Activation of the BRCA1/Chk1/p53/p21(Cip1/Waf1) pathway by nitric oxide and cell cycle arrest in human neuroblastoma NB69 cells.
22357623 2012 P90 RSK arranges Chk1 in the nucleus for monitoring of genomic integrity during cell proliferation.
22231448 2012 Chk1 phosphorylation of Metnase enhances DNA repair but inhibits replication fork restart.
22203733 2012 Preclinical development of the novel Chk1 inhibitor SCH900776 in combination with DNA-damaging agents and antimetabolites.
22184239 2012 Checkpoint kinase 1 (Chk1)-short is a splice variant and endogenous inhibitor of Chk1 that regulates cell cycle and DNA damage checkpoints.
22159421 2011 WRN helicase regulates the ATR-CHK1-induced S-phase checkpoint pathway in response to topoisomerase-I-DNA covalent complexes.
22134241 2011 Selective radiosensitization of p53 mutant pancreatic cancer cells by combined inhibition of Chk1 and PARP1.
22106282 2011 Role of checkpoint kinase 1 (Chk1) in the mechanisms of resistance to histone deacetylase inhibitors.
22080164 2012 Inhibition of checkpoint kinase 1 abrogates G2/M checkpoint activation and promotes apoptosis under heat stress.
22044003 2012 Synthesis of Cis-fused pyran indolocarbazole derivatives that inhibit FLT3 kinase and the DNA damage kinase, checkpoint kinase 1.
22024163 2011 Phosphorylation at serine 331 is required for Aurora B activation.
21995812 2011 Differential roles for Chk1 and FANCD2 in ATR-mediated signalling for psoralen photoactivation-induced senescence.
21921034 2011 Disruption of serine/threonine protein phosphatase 5 (PP5:PPP5c) in mice reveals a novel role for PP5 in the regulation of ultraviolet light-induced phosphorylation of serine/threonine protein kinase Chk1 (CHEK1).
21907702 2011 Cdk phosphorylation of Chk1 regulates efficient Chk1 activation and multiple checkpoint proficiency.
21858151 2011 Structure-specific DNA endonuclease Mus81/Eme1 generates DNA damage caused by Chk1 inactivation.
21803008 2011 Frequent alterations of LOH11CR2A, PIG8 and CHEK1 genes at chromosomal 11q24.1-24.2 region in breast carcinoma: clinical and prognostic implications.
21752283 2011 Integrin subunits alpha5 and alpha6 regulate cell cycle by modulating the chk1 and Rb/E2F pathways to affect breast cancer metastasis.
21680529 2011 Parvovirus B19 infection of human primary erythroid progenitor cells triggers ATR-Chk1 signaling, which promotes B19 virus replication.
21628425 2011 Nuclear Chk1 prevents premature mitotic entry.
21615992 2011 Knock-down of human MutY homolog (hMYH) decreases phosphorylation of checkpoint kinase 1 (Chk1) induced by hydroxyurea and UV treatment.
21557990 2011 Transient knock down of checkpoint kinase 1 in hematopoietic progenitors is linked to bone marrow toxicity.
21532626 2011 Chk1 is dispensable for G2 arrest in response to sustained DNA damage when the ATM/p53/p21 pathway is functional.
21502314 2011 Tethering DNA damage checkpoint mediator proteins topoisomerase IIbeta-binding protein 1 (TopBP1) and Claspin to DNA activates ataxia-telangiectasia mutated and RAD3-related (ATR) phosphorylation of checkpoint kinase 1 (Chk1).
21440578 2011 Glucose deprivation is associated with Chk1 degradation through the ubiquitin-proteasome pathway and effective checkpoint response to replication blocks.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21401699 2011 Detection of CHK1 and CCND1 gene copy number changes in breast cancer with dual-colour fluorescence in-situ hybridization.
21389083 2011 USP1 deubiquitinase maintains phosphorylated CHK1 by limiting its DDB1-dependent degradation.
21383502 2011 Genomic DNA damage and ATR-Chk1 signaling determine oncolytic adenoviral efficacy in human ovarian cancer cells.
21301228 2011 The DNA damage effector Chk1 kinase regulates Cdc14B nucleolar shuttling during cell cycle progression.
21269460 2011 Initial characterization of the human central proteome.
21212274 2011 TAp73 induction by nitric oxide: regulation by checkpoint kinase 1 (CHK1) and protection against apoptosis.
21179472 2010 Histone deacetylase inhibitors downregulate checkpoint kinase 1 expression to induce cell death in non-small cell lung cancer cells.
21173116 2010 Chk1 inhibits replication factory activation but allows dormant origin firing in existing factories.
21171266 2010 [Expression of Chk1 in human sperm and its significance].
21154811 2011 Inactivation of CHEK1 and EI24 is associated with the development of invasive cervical carcinoma: clinical and prognostic implications.
21118956 2011 A novel Chk1/2-Lats2-14-3-3 signaling pathway regulates P-body formation in response to UV damage.
21051833 2010 [Expression of checkpoint kinase 1 and polo-like kinase 1 and its clinicopathological significance in benign and malignant lesions of the stomach].
21034966 2010 The ATM-Chk2 and ATR-Chk1 pathways in DNA damage signaling and cancer.
20969866 2010 Menin stimulates homology-directed DNA repair.
20932473 2010 DNA damage activates a spatially distinct late cytoplasmic cell-cycle checkpoint network controlled by MK2-mediated RNA stabilization.
20805465 2010 Chk1 promotes replication fork progression by controlling replication initiation.
20731661 2010 Comprehensive analysis of DNA repair gene polymorphisms and survival in patients with early stage non-small-cell lung cancer.
20719863 2010 Chk1-dependent constitutive phosphorylation of BLM helicase at serine 646 decreases after DNA damage.
20716119 2011 Cutting edge: Chk1 directs senescence and mitotic catastrophe in recovery from G? checkpoint arrest.
20644561 2011 A large-scale candidate gene approach identifies SNPs in SOD2 and IL13 as predictive markers of response to preoperative chemoradiation in rectal cancer.
20639859 2010 14-3-3gamma mediates Cdc25A proteolysis to block premature mitotic entry after DNA damage.
20616048 2010 Reconstitution of RPA-covered single-stranded DNA-activated ATR-Chk1 signaling.
20599444 2010 Cell cycle control pathways act as conditioning factors for TK/GCV sensitivity in pancreatic cancer cells.
20581453 2010 Mitotic DNA damage response: Polo-like kinase-1 is dephosphorylated through ATM-Chk1 pathway.
20567916 2010 Screening for large genomic rearrangements of the BRIP1 and CHK1 genes in Finnish breast cancer families.
20514472 2010 Pectenotoxin-2 induces G2/M phase cell cycle arrest in human breast cancer cells via ATM and Chk1/2-mediated phosphorylation of cdc25C.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
20496165 2011 Comprehensive screen of genetic variation in DNA repair pathway genes and postmenopausal breast cancer risk.
20495005 2010 Akt activation emulates Chk1 inhibition and Bcl2 overexpression and abrogates G2 cell cycle checkpoint by inhibiting BRCA1 foci.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20233725 2010 Tipin-replication protein A interaction mediates Chk1 phosphorylation by ATR in response to genotoxic stress.
20159774 2010 A DNA damage-activated checkpoint kinase phosphorylates tau and enhances tau-induced neurodegeneration.
20146081 2010 Role of Chk1 in the differentiation program of hematopoietic stem cells.
20123862 2010 ATR/Chk1 pathway is essential for resumption of DNA synthesis and cell survival in UV-irradiated XP variant cells.
20090422 2010 NEK11: linking CHK1 and CDC25A in DNA damage checkpoint signaling.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20068082 2010 New insights into checkpoint kinase 1 in the DNA damage response signaling network.
20053681 2010 Enhanced H2AX phosphorylation, DNA replication fork arrest, and cell death in the absence of Chk1.
20029092 2010 Interactions of human mismatch repair proteins MutSalpha and MutLalpha with proteins of the ATR-Chk1 pathway.
19931269 2010 Fhit loss in lung preneoplasia: relation to DNA damage response checkpoint activation.
19903823 2010 Large T antigen promotes JC virus replication in G2-arrested cells by inducing ATM- and ATR-mediated G2 checkpoint signaling.
19861535 2009 Fanconi anemia complementation group FANCD2 protein serine 331 phosphorylation is important for fanconi anemia pathway function and BRCA2 interaction.
19843865 2009 Constitutive activation of the DNA damage signaling pathway in acute myeloid leukemia with complex karyotype: potential importance for checkpoint targeting therapy.
19838212 2010 DNA damage induces Chk1-dependent threonine-160 phosphorylation and activation of Cdk2.
19837665 2009 Novel positive feedback loop between Cdk1 and Chk1 in the nucleus during G2/M transition.
19828454 2009 Reconstitution of human claspin-mediated phosphorylation of Chk1 by the ATR (ataxia telangiectasia-mutated and rad3-related) checkpoint kinase.
19778378 2009 U2OS cells lacking Chk1 undergo aberrant mitosis and fail to activate the spindle checkpoint.
19743875 2009 Characterization of the CHK1 allosteric inhibitor binding site.
19734889 2009 NEK11 regulates CDC25A degradation and the IR-induced G2/M checkpoint.
19716789 2009 The F box protein Fbx6 regulates Chk1 stability and cellular sensitivity to replication stress.
19714462 2010 Genetic variation in genes interacting with BRCA1/2 and risk of breast cancer in the Cypriot population.
19694479 2009 Interaction with checkpoint kinase 1 modulates the recruitment of nucleophosmin to chromatin.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19690177 2009 Polymorphic variants in hereditary pancreatic cancer genes are not associated with pancreatic cancer risk.
19628579 2009 Identification of XAF1 as a novel cell cycle regulator through modulating G(2)/M checkpoint and interaction with checkpoint kinase 1 in gastrointestinal cancer.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19615254 2009 [Down-regulation of Chk1/Chk2 gene expression increases apoptosis in irradiated HeLa cells and its mechanism].
19593445 2009 Expression of the Bcl-2 protein BAD promotes prostate cancer growth.
19584159 2009 PF-00477736 mediates checkpoint kinase 1 signaling pathway and potentiates docetaxel-induced efficacy in xenografts.
19570909 2009 Reduced ATR or Chk1 expression leads to chromosome instability and chemosensitization of mismatch repair-deficient colorectal cancer cells.
19546241 2009 Microcephalin and pericentrin regulate mitotic entry via centrosome-associated Chk1.
19487575 2009 A role for Chk1 in blocking transcriptional elongation of p21 RNA during the S-phase checkpoint.
19477924 2009 Cdh1 regulates cell cycle through modulating the claspin/Chk1 and the Rb/E2F1 pathways.
19473886 2009 Taking the time to make important decisions: the checkpoint effector kinases Chk1 and Chk2 and the DNA damage response.
19453842 2009 Cellular effects of genotoxic stress and gene silencing of the checkpoint kinases in human oral cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19401701 2009 Activation of ATM/Chk1 by curcumin causes cell cycle arrest and apoptosis in human pancreatic cancer cells.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19330022 2009 Human FEM1B is required for Rad9 recruitment and CHK1 activation in response to replication stress.
19276361 2009 DDB1 targets Chk1 to the Cul4 E3 ligase complex in normal cycling cells and in cells experiencing replication stress.
19270516 2009 Claspin and Chk1 regulate replication fork stability by different mechanisms.
19242509 2009 ATR-Chk1 pathway inhibition promotes apoptosis after UV treatment in primary human keratinocytes: potential basis for the UV protective effects of caffeine.
19223857 2009 Tumor suppressor protein C53 antagonizes checkpoint kinases to promote cyclin-dependent kinase 1 activation.
19177015 2009 Replication stress activates DNA polymerase alpha-associated Chk1.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
19119425 2009 ATR and Chk1 suppress a caspase-3-dependent apoptotic response following DNA replication stress.
19091954 2008 Essential function of Chk1 can be uncoupled from DNA damage checkpoint and replication control.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19064565 2008 Common single-nucleotide polymorphisms in DNA double-strand break repair genes and breast cancer risk.
19060337 2009 Dual regulation of Cdc25A by Chk1 and p53-ATF3 in DNA replication checkpoint control.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
18983824 2008 Chk1 phosphorylation at Ser286 and Ser301 occurs with both stalled DNA replication and damage checkpoint stimulation.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
18820127 2009 90-kDa heat shock protein inhibition abrogates the topoisomerase I poison-induced G2/M checkpoint in p53-null tumor cells by depleting Chk1 and Wee1.
18728393 2008 Nek6 is involved in G2/M phase cell cycle arrest through DNA damage-induced phosphorylation.
18723495 2008 Cellular commitment to reentry into the cell cycle after stalled DNA is determined by site-specific phosphorylation of Chk1 and PTEN.
18698031 2008 Checkpoint kinase 1 down-regulation by an inducible small interfering RNA expression system sensitized in vivo tumors to treatment with 5-fluorouracil.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18671143 2008 Cyclin B1 is an efficacy-predicting biomarker for Chk1 inhibitors.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18642443 2008 Chk1 inhibition activates p53 through p38 MAPK in tetraploid cancer cells.
18632613 2008 Thymoquinone triggers inactivation of the stress response pathway sensor CHEK1 and contributes to apoptosis in colorectal cancer cells.
18566216 2008 Chk1 and Chk2 are differentially involved in homologous recombination repair and cell cycle arrest in response to DNA double-strand breaks induced by camptothecins.
18550533 2008 Cleavage-mediated activation of Chk1 during apoptosis.
18510930 2008 Chk1 suppresses a caspase-2 apoptotic response to DNA damage that bypasses p53, Bcl-2, and caspase-3.
18495871 2008 An essential role for MCL-1 in ATR-mediated CHK1 phosphorylation.
18480045 2008 Differential roles for checkpoint kinases in DNA damage-dependent degradation of the Cdc25A protein phosphatase.
18469532 2008 DNA damage-induced S phase arrest in human breast cancer depends on Chk1, but G2 arrest can occur independently of Chk1, Chk2 or MAPKAPK2.
18451105 2008 Chk1 and Claspin potentiate PCNA ubiquitination.
18448427 2008 A conserved proliferating cell nuclear antigen-interacting protein sequence in Chk1 is required for checkpoint function.
18434539 2008 DNA synthesis from unbalanced nucleotide pools causes limited DNA damage that triggers ATR-CHK1-dependent p53 activation.
18424430 2008 Expanded roles for Chk1 in genome maintenance.
18381943 2008 Single-nucleotide polymorphisms of DNA damage response genes are associated with overall survival in patients with pancreatic cancer.
18346918 BCL6 represses CHEK1 and suppresses DNA damage pathways in normal and malignant B-cells.
18339864 2008 Triggering senescence programs suppresses Chk1 kinase and sensitizes cells to genotoxic stresses.
18331829 2008 Claspin is phosphorylated in the Chk1-binding domain by a kinase distinct from Chk1.
18317453 2008 The checkpoint kinases Chk1 and Chk2 regulate the functional associations between hBRCA2 and Rad51 in response to DNA damage.
18270339 2008 Comprehensive analysis of DNA repair gene variants and risk of meningioma.
18247328 2008 Involvement of the role of Chk1 in lithium-induced G2/M phase cell cycle arrest in hepatocellular carcinoma cells.
18243098 2008 Chk1 is a histone H3 threonine 11 kinase that regulates DNA damage-induced transcriptional repression.
18239674 2008 Apoptosis induced by replication inhibitors in Chk1-depleted cells is dependent upon the helicase cofactor Cdc45.
18229454 2007 Functioning of the Hsp90 machine in chaperoning checkpoint kinase I (Chk1) and the progesterone receptor (PR).
18159231 2007 Inhibition of Chk1 kills tetraploid tumor cells through a p53-dependent pathway.
18088187 2007 p53-dependent Chk1 phosphorylation is required for maintenance of prolonged G2 Arrest.
18071310 2008 Hsp90-inhibitor geldanamycin abrogates G2 arrest in p53-negative leukemia cell lines through the depletion of Chk1.
18029388 2008 Loss of CHK1 function impedes DNA damage-induced FANCD2 monoubiquitination but normalizes the abnormal G2 arrest in Fanconi anemia.
17986860 2007 The mammalian DNA replication elongation checkpoint: implication of Chk1 and relationship with origin firing as determined by single DNA molecule and single cell analyses.
17912454 2007 The regulatory beta-subunit of protein kinase CK2 accelerates the degradation of CDC25A phosphatase through the checkpoint kinase Chk1.
17879369 2007 Mutations in the ataxia telangiectasia and rad3-related-checkpoint kinase 1 DNA damage response axis in colon cancers.
17726372 2007 DNA damage-induced accumulation of centrosomal Chk1 contributes to its checkpoint function.
17716975 2007 ATR pathway is the primary pathway for activating G2/M checkpoint induction after re-replication.
17684142 2007 Polymorphisms in apoptosis and cell cycle control genes and risk of brain tumors in adults.
17638866 2007 The E2F-regulated gene Chk1 is highly expressed in triple-negative estrogen receptor /progesterone receptor /HER-2 breast carcinomas.
17611684 2007 Zoledronate-induced S phase arrest and apoptosis accompanied by DNA damage and activation of the ATM/Chk1/cdc25 pathway in human osteosarcoma cells.
17544403 2007 Reoxygenation following hypoxia activates DNA-damage checkpoint signaling pathways that suppress cell-cycle progression in cultured human lymphocytes.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17491592 2007 Chk1 regulates the density of active replication origins during the vertebrate S phase.
17468739 2007 DNA damage induces Chk1-dependent centrosome amplification.
17464182 2007 Identification of novel substrates for human checkpoint kinase Chk1 and Chk2 through genome-wide screening using a consensus Chk phosphorylation motif.
17408908 2007 Chk1 frameshift mutation in sporadic and hereditary non-polyposis colorectal cancers with microsatellite instability.
17380128 2007 Phosphorylation of pRB at Ser612 by Chk1/2 leads to a complex between pRB and E2F-1 after DNA damage.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17296736 2007 Chk1-mediated phosphorylation of FANCE is required for the Fanconi anemia/BRCA pathway.
17292828 2007 p53-deficient cells rely on ATM- and ATR-mediated checkpoint signaling through the p38MAPK/MK2 pathway for survival after DNA damage.
17276342 2007 Chk1 is required for spindle checkpoint function.
17274954 2007 Linking PCNA-dependent replication and ATR by human Claspin.
17157788 2006 Che-1 phosphorylation by ATM/ATR and Chk2 kinases activates p53 transcription and the G2/M checkpoint.
17106257 2006 Chk1-dependent regulation of Cdc25B functions to coordinate mitotic events.
17102638 2006 Ectopic expression of Plk1 leads to activation of the spindle checkpoint.
17015476 2006 Phosphorylation of Chk1 by ATR is antagonized by a Chk1-regulated protein phosphatase 2A circuit.
17003105 2006 CHK1 phosphorylates CDC25B during the cell cycle in the absence of DNA damage.
16963448 2006 Repeated phosphopeptide motifs in human Claspin are phosphorylated by Chk1 and mediate Claspin function.
16951182 2006 Chk1- and claspin-dependent but ATR/ATM- and Rad17-independent DNA replication checkpoint response in HeLa cells.
16927022 2006 Influence of chk1 and plk1 silencing on radiation- or cisplatin-induced cytotoxicity in human malignant cells.
16912045 2006 The Chk1-mediated S-phase checkpoint targets initiation factor Cdc45 via a Cdc25A/Cdk2-independent mechanism.
16885021 2006 Destruction of Claspin by SCFbetaTrCP restrains Chk1 activation and facilitates recovery from genotoxic stress.
16880517 2006 Claspin operates downstream of TopBP1 to direct ATR signaling towards Chk1 activation.
16873548 2006 Checkpoint kinase 1 (Chk1) is required for mitotic progression through negative regulation of polo-like kinase 1 (Plk1).
16828751 2006 Regulation of Claspin degradation by the ubiquitin-proteosome pathway during the cell cycle and in response to ATR-dependent checkpoint activation.
16732333 2006 Depletion of CHK1, but not CHK2, induces chromosomal instability and breaks at common fragile sites.
16652144 2006 Oxidative stress induces a prolonged but reversible arrest in p53-null cancer cells, involving a Chk1-dependent G2 checkpoint.
16649252 2006 Checkpoint kinase 1-mediated phosphorylation of Cdc25C and bad proteins are involved in antitumor effects of loratadine-induced G2/M phase cell-cycle arrest and apoptosis.
16629900 2006 Regulation of mitotic function of Chk1 through phosphorylation at novel sites by cyclin-dependent kinase 1 (Cdk1).
16619043 2006 Chk1-dependent slowing of S-phase progression protects DT40 B-lymphoma cells against killing by the nucleoside analogue 5-fluorouracil.
16581803 2006 Chk1 requirement for high global rates of replication fork progression during normal vertebrate S phase.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16511572 2006 14-3-3gamma binds to MDMX that is phosphorylated by UV-activated Chk1, resulting in p53 activation.
16501606 2006 Chk1 is required to maintain claspin stability.
16414312 2006 Targeted gene repair activates Chk1 and Chk2 and stalls replication in corrected cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16330544 2006 Chaperoning checkpoint kinase 1 (Chk1), an Hsp90 client, with purified chaperones.
16280359 2006 Chk1 and p21 cooperate to prevent apoptosis during DNA replication fork stress.
16217032 2005 BRIT1/MCPH1 is a DNA damage responsive protein that regulates the Brca1-Chk1 pathway, implicating checkpoint dysfunction in microcephaly.
16163388 2005 ATM and Chk2-dependent phosphorylation of MDMX contribute to p53 activation after DNA damage.
16159883 2005 Depletion of Chk1 leads to premature activation of Cdc2-cyclin B and mitotic catastrophe.
16137618 2005 Genotoxic stress targets human Chk1 for degradation by the ubiquitin-proteasome pathway.
16123041 2005 Cleavage of claspin by caspase-7 during apoptosis inhibits the Chk1 pathway.
15974586 2005 Structure-based design of novel Chk1 inhibitors: insights into hydrogen bonding and protein-ligand affinity.
15961392 2005 Checkpoint kinase 1 regulates diallyl trisulfide-induced mitotic arrest in human prostate cancer cells.
15870257 2005 PPM1D dephosphorylates Chk1 and p53 and abrogates cell cycle checkpoints.
15831461 2005 Inhibition of human Chk1 causes increased initiation of DNA replication, phosphorylation of ATR targets, and DNA breakage.
15798197 2005 Coupling of human circadian and cell cycles by the timeless protein.
15775976 2005 Regulation of NF-kappaB and p53 through activation of ATR and Chk1 by the ARF tumour suppressor.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15743907 2005 ATRIP binding to replication protein A-single-stranded DNA promotes ATR-ATRIP localization but is dispensable for Chk1 phosphorylation.
15710331 2005 Lack of PTEN sequesters CHK1 and initiates genetic instability.
15707391 2005 DNA-dependent phosphorylation of Chk1 and Claspin in a human cell-free system.
15705874 2005 Cdk inhibition in human cells compromises chk1 function and activates a DNA damage response.
15699047 2005 The role of checkpoint kinase 1 in sensitivity to topoisomerase I poisons.
15688426 2005 Novel indication for cancer therapy: Chk1 inhibition sensitizes tumor cells to antimitotics.
15665856 2005 The cell-cycle checkpoint kinase Chk1 is required for mammalian homologous recombination repair.
15659650 2005 p53 C-terminal phosphorylation by CHK1 and CHK2 participates in the regulation of DNA-damage-induced C-terminal acetylation.
15655357 2005 CHK1 affecting cell radiosensitivity is independent of non-homologous end joining.
15650047 2005 DNA damage-induced mitotic catastrophe is mediated by the Chk1-dependent mitotic exit DNA damage checkpoint.
15647386 2005 Methylator-induced, mismatch repair-dependent G2 arrest is activated through Chk1 and Chk2.
15601819 2004 p73 induction after DNA damage is regulated by checkpoint kinases Chk1 and Chk2.
15539958 2005 Chk1 is essential for tumor cell viability following activation of the replication checkpoint.
15526025 2005 Checkpoint kinase 1 (CHK1) protein and mRNA expression is downregulated in aggressive variants of human lymphoid neoplasms.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15326376 2004 Chk1, but not Chk2, is involved in the cellular response to DNA damaging agents: differential activity in cells expressing or not p53.
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15311285 2004 Centrosome-associated Chk1 prevents premature activation of cyclin-B-Cdk1 kinase.
15279790 Claspin, a regulator of Chk1 in DNA replication stress pathway.
15225637 2004 Phosphorylation of the regulatory beta-subunit of protein kinase CK2 by checkpoint kinase Chk1: identification of the in vitro CK2beta phosphorylation site.
15220350 2004 Microcephalin is a DNA damage response protein involved in regulation of CHK1 and BRCA1.
15149599 2004 Telomere shortening triggers senescence of human cells through a pathway involving ATM, p53, and p21(CIP1), but not p16(INK4a).
14988723 2004 The DNA crosslink-induced S-phase checkpoint depends on ATR-CHK1 and ATR-NBS1-FANCD2 pathways.
14759516 2004 Interaction of checkpoint kinase 1 and the X-linked inhibitor of apoptosis during mitosis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14681223 2004 Differential mode of regulation of the checkpoint kinases CHK1 and CHK2 by their regulatory domains.
14681206 2003 SCFbeta-TRCP links Chk1 signaling to degradation of the Cdc25A protein phosphatase.
14657349 2003 MSH2 and ATR form a signaling module and regulate two branches of the damage response to DNA methylation.
14624239 2003 Biochemical characterization of DNA damage checkpoint complexes: clamp loader and clamp complexes with specificity for 5' recessed DNA.
14570880 2003 Hsp90 inhibition depletes Chk1 and sensitizes tumor cells to replication stress.
14559997 2003 Chk1 kinase negatively regulates mitotic function of Cdc25A phosphatase through 14-3-3 binding.
14504477 Characterization of the 5'flanking region of the human Chk1 gene: identification of E2F1 functional sites.
12959929 2004 Hyperoxia activates the ATR-Chk1 pathway and phosphorylates p53 at multiple sites.
12955071 2003 Suppression of Tousled-like kinase activity after DNA damage or replication block requires ATM, NBS1 and Chk1.
12902976 2003 Modulation of human checkpoint kinase Chk1 by the regulatory beta-subunit of protein kinase CK2.
12813133 2003 Human Chk1 expression is dispensable for somatic cell death and critical for sustaining G2 DNA damage checkpoint.
12791985 2003 Sensing DNA damage through ATRIP recognition of RPA-ssDNA complexes.
12791699 2003 An overactivated ATR/CHK1 pathway is responsible for the prolonged G2 accumulation in irradiated AT cells.
12766152 2003 Human claspin is required for replication checkpoint control.
12759351 2003 Phosphorylation at serine 75 is required for UV-mediated degradation of human Cdc25A phosphatase at the S-phase checkpoint.
12756247 2003 Regulatory interactions between the checkpoint kinase Chk1 and the proteins of the DNA-dependent protein kinase complex.
12738771 2003 Activation of the ATR-mediated DNA damage response by the HIV-1 viral protein R.
12676962 2003 Regulation of Chk1 includes chromatin association and 14-3-3 binding following phosphorylation on Ser-345.
12676925 2003 Chk1 mediates S and G2 arrests through Cdc25A degradation in response to DNA-damaging agents.
12676583 2003 Chk1 regulates the S phase checkpoint by coupling the physiological turnover and ionizing radiation-induced accelerated proteolysis of Cdc25A.
12660173 2003 Human Tousled like kinases are targeted by an ATM- and Chk1-dependent DNA damage checkpoint.
12588868 2003 Ataxia-telangiectasia-mutated (ATM) and NBS1-dependent phosphorylation of Chk1 on Ser-317 in response to ionizing radiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12446774 2002 An ATR- and Chk1-dependent S checkpoint inhibits replicon initiation following UVC-induced DNA damage.
12399544 2002 Disruption of the checkpoint kinase 1/cell division cycle 25A pathway abrogates ionizing radiation-induced S and G2 checkpoints.
12244092 2002 Structural basis for Chk1 inhibition by UCN-01.
12150968 2002 Chk1 signaling pathways that mediated G(2)M checkpoint in relation to the cellular resistance to the novel topoisomerase I poison BNP1350.
12062056 2002 A role for PI 3-kinase and PKB activity in the G2/M phase of the cell cycle.
11896572 Radiation-induced phosphorylation of Chk1 at S345 is associated with p53-dependent cell cycle arrest pathways.
11836499 2002 BRCA1 regulates the G2/M checkpoint by activating Chk1 kinase upon DNA damage.
11821419 2002 Determination of substrate motifs for human Chk1 and hCds1/Chk2 by the oriented peptide library approach.
11709713 2001 UV-radiation induces dose-dependent regulation of p53 response and modulates p53-HDM2 interaction in human fibroblasts.
11551930 2001 Plk3 functionally links DNA damage to cell cycle arrest and apoptosis at least in part via the p53 pathway.
11535615 2001 Activation of mammalian Chk1 during DNA replication arrest: a role for Chk1 in the intra-S phase checkpoint monitoring replication origin firing.
11390642 2001 ATR-mediated checkpoint pathways regulate phosphorylation and activation of human Chk1.
11333986 2001 Initiation of a G2/M checkpoint after ultraviolet radiation requires p38 kinase.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
11252893 2000 The many substrates and functions of ATM.
10859164 2000 Chk1 is an essential kinase that is regulated by Atr and required for the G(2)/M DNA damage checkpoint.
10761933 2000 The 1.7 A crystal structure of human cell cycle checkpoint kinase Chk1: implications for Chk1 regulation.
10717241 2000 Analysis of the candidate target genes for mutation in microsatellite instability-positive cancers of the colorectum, stomach, and endometrium.
10681541 2000 The Chk1 protein kinase and the Cdc25C regulatory pathways are targets of the anticancer agent UCN-01.
10673501 2000 The human homologs of checkpoint kinases Chk1 and Cds1 (Chk2) phosphorylate p53 at multiple DNA damage-inducible sites.
10557092 1999 The physical association and phosphorylation of Cdc25C protein phosphatase by Prk.
9765199 1998 The complexity of p53 modulation: emerging patterns from divergent signals.
9382850 1997 Atm-dependent interactions of a mammalian chk1 homolog with meiotic chromosomes.
9278512 1997 Mitotic and G2 checkpoint control: regulation of 14-3-3 protein binding by phosphorylation of Cdc25C on serine-216.
9278511 1997 Conservation of the Chk1 checkpoint pathway in mammals: linkage of DNA damage to Cdk regulation through Cdc25.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.