Property Summary

Ligand Count 847
NCBI Gene PubMed Count 398
PubMed Score 1089.60
PubTator Score 805.37

Knowledge Summary

Patent (55,198)

TINX Plot

  Disease (5)

Expression

  Differential Expression (27)

Disease log2 FC p
adrenocortical carcinoma 1.007 2.3e-02
adult high grade glioma 1.800 1.9e-04
Atopic dermatitis 1.200 1.8e-03
atypical teratoid / rhabdoid tumor 3.000 7.7e-09
Breast cancer 1.100 4.0e-05
colon cancer 2.000 7.3e-04
cystic fibrosis 1.411 7.8e-06
ductal carcinoma in situ 1.300 7.0e-03
Endometriosis 1.029 3.3e-02
ependymoma 1.200 5.1e-06
glioblastoma 2.300 3.6e-07
group 3 medulloblastoma 3.600 2.4e-06
intraductal papillary-mucinous carcinoma... 1.100 3.2e-03
intraductal papillary-mucinous neoplasm ... 2.600 8.9e-05
invasive ductal carcinoma 1.700 1.9e-03
lung adenocarcinoma 1.400 4.5e-10
lung cancer 2.100 4.6e-05
malignant mesothelioma 1.100 2.5e-06
medulloblastoma, large-cell 3.600 9.5e-08
nasopharyngeal carcinoma 1.300 3.4e-03
non-small cell lung cancer 2.126 4.9e-25
ovarian cancer 1.600 1.4e-03
pancreatic cancer 1.200 8.9e-04
primitive neuroectodermal tumor 3.100 2.0e-05
psoriasis 1.500 1.5e-03
tuberculosis and treatment for 6 months 1.200 3.5e-02
ulcerative colitis 1.100 6.3e-04

Synonym

Accession O14757 A8K934 B4DDD0 B4DSK3 B5BTY6 F5H7S4 H2BI51
Symbols CHK1

Gene

PDB

1IA8   1NVQ   1NVR   1NVS   1ZLT   1ZYS   2AYP   2BR1   2BRB   2BRG   2BRH   2BRM   2BRN   2BRO   2C3J   2C3K   2C3L   2CGU   2CGV   2CGW   2CGX   2E9N   2E9O   2E9P   2E9U   2E9V   2GDO   2GHG   2HOG   2HXL   2HXQ   2HY0   2QHM   2QHN   2R0U   2WMQ   2WMR   2WMS   2WMT   2WMU   2WMV   2WMW   2WMX   2X8D   2X8E   2X8I   2XEY   2XEZ   2XF0   2YDI   2YDJ   2YDK   2YER   2YEX   2YM3   2YM4   2YM5   2YM6   2YM7   2YM8   2YWP   3F9N   3JVR   3JVS   3NLB   3OT3   3OT8   3PA3   3PA4   3PA5   3TKH   3TKI   3U9N   4FSM   4FSN   4FSQ   4FSR   4FST   4FSU   4FSW   4FSY   4FSZ   4FT0   4FT3   4FT5   4FT7   4FT9   4FTA   4FTC   4FTI   4FTJ   4FTK   4FTL   4FTM   4FTN   4FTO   4FTQ   4FTR   4FTT   4FTU   4GH2   4HYH   4HYI   4JIK   4QYE   4QYF   4QYG   4QYH   4RVK   4RVL   4RVM   5DLS   5F4N   5OOP   5OOR   5OOT   5OP2   5OP4   5OP5   5OP7   5OPB   5OPR   5OPS   5OPU   5OPV   5OQ5   5OQ6   5OQ7   5OQ8  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (352)

AA Sequence

MAVPFVEDWDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMKRAVDCPENIKKEICINKMLNHENVVKF      1 - 70
YGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEPDAQRFFHQLMAGVVYLHGIGITHRDIKPENLLLDE     71 - 140
RDNLKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLKRREFHAEPVDVWSCGIVLTAMLAGELPWDQ    141 - 210
PSDSCQEYSDWKEKKTYLNPWKKIDSAPLALLHKILVENPSARITIPDIKKDRWYNKPLKKGAKRPRVTS    211 - 280
GGVSESPSGFSKHIQSNLDFSPVNSASSEENVKYSSSQPEPRTGLSLWDTSPSYIDKLVQGISFSQPTCP    281 - 350
DHMLLNSQLLGTPGSSQNPWQRLVKRMTRFFTKLDADKSYQCLKETCEKLGYQWKKSCMNQVTISTTDRR    351 - 420
NNKLIFKVNLLEMDDKILVDFRLSKGDGLEFKRHFLKIKGKLIDIVSSQKIWLPAT                  421 - 476
//

Text Mined References (416)

PMID Year Title