Property Summary

NCBI Gene PubMed Count 20
PubMed Score 27.05
PubTator Score 136.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Astrocytoma, Pilocytic 1.500 4.2e-03
atypical teratoid / rhabdoid tumor -1.100 2.8e-05
fibroadenoma 1.800 3.0e-02
group 3 medulloblastoma -1.500 1.1e-05
inflammatory breast cancer -1.500 4.8e-03
intraductal papillary-mucinous carcinoma... 1.200 4.3e-03
lung carcinoma 2.600 1.2e-35
medulloblastoma, large-cell -1.200 5.9e-04
osteosarcoma -1.162 2.1e-04
ovarian cancer -1.200 3.8e-06
pituitary cancer -1.900 3.1e-08
psoriasis -1.200 4.7e-48

Gene RIF (15)

AA Sequence

MWCLLRGLGRPGALARGALGQQQSLGARALASAGSESRDEYSYVVVGAGSAGCVLAGRLTEDPAERVLLL      1 - 70
EAGPKDVLAGSKRLSWKIHMPAALVANLCDDRYNWCYHTEVQRGLDGRVLYWPRGRVWGGSSSLNAMVYV     71 - 140
RGHAEDYERWQRQGARGWDYAHCLPYFRKAQGHELGASRYRGADGPLRVSRGKTNHPLHCAFLEATQQAG    141 - 210
YPLTEDMNGFQQEGFGWMDMTIHEGKRWSAACAYLHPALSRTNLKAEAETLVSRVLFEGTRAVGVEYVKN    211 - 280
GQSHRAYASKEVILSGGAINSPQLLMLSGIGNADDLKKLGIPVVCHLPGVGQNLQDHLEIYIQQACTRPI    281 - 350
TLHSAQKPLRKVCIGLEWLWKFTGEGATAHLETGGFIRSQPGVPHPDIQFHFLPSQVIDHGRVPTQQEAY    351 - 420
QVHVGPMRGTSVGWLKLRSANPQDHPVIQPNYLSTETDIEDFRLCVKLTREIFAQEALAPFRGKELQPGS    421 - 490
HIQSDKEIDAFVRAKADSAYHPSCTCKMGQPSDPTAVVDPQTRVLGVENLRVVDASIMPSMVSGNLNAPT    491 - 560
IMIAEKAADIIKGQPALWDKDVPVYKPRTLATQR                                        561 - 594
//

Text Mined References (22)

PMID Year Title