Property Summary

NCBI Gene PubMed Count 38
PubMed Score 17.78
PubTator Score 51.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytoma -2.100 2.2e-28
posterior fossa group A ependymoma -3.300 1.3e-16
oligodendroglioma -2.100 1.4e-21
glioblastoma -3.400 2.2e-06
medulloblastoma -2.900 3.6e-08
atypical teratoid / rhabdoid tumor -3.300 7.2e-09
medulloblastoma, large-cell -3.500 4.2e-05
primitive neuroectodermal tumor -1.900 1.4e-02
adult high grade glioma -3.300 3.0e-06
pilocytic astrocytoma -3.200 9.8e-10
lung carcinoma 1.700 3.7e-40
psoriasis -1.500 1.2e-25

Gene RIF (29)

PMID Text
26753653 CHD5 methylation of rectal cancer has a great effect in influencing its clinical and pathological features.
26517514 Data show a mutual suppression regulation between chromodomain helicase DNA binding protein 5 (CHD5) and enhancer of zeste homolog 2 (EZH2, which may provide new insights into their potential therapeutic significance for hepatocellular carcinoma (HCC).
25247294 Study shows that CHD5 is a Nucleosome remodeling and deacetylase complex-associated transcriptional repressor and identifies WEE1 as one of the CHD5-regulated genes that may link CHD5 to tumor suppression.
24923445 The tumor suppressor chromodomain helicase DNA-binding protein 5 (CHD5) remodels nucleosomes by unwrapping.
24529164 CHD5 is a potential tumour suppressor gene epigenetically silenced in hepatocellular carcinoma.
24454811 repression of CHD5 gene expression in human leukemia is mediated in part by DNA methylation of its promoter.
24276239 Low CHD5 expression activates the DNA damage response and predicts poor outcome in patients undergoing adjuvant therapy for resected pancreatic cancer.
24243398 CHD5 activity is regulated by DNA methylation and repressive histone modifications. CHD5 likely acts as a tumor-suppressor gene in early colorectal carcinogenesis.
23948251 These findings provide insights into the regulatory role of CHD5 during neurogenesis and suggest how inactivation of this candidate tumor suppressor might contribute to neuroblastoma.
23707602 CHD5 might act as a tumor suppressor in glioma
23168260 CHD% protein mediates the p53-dependent senescence program triggered by decreased JMJD2A levels.
22910690 In this Caucasian population, endometriosis seems to be associated with the tumor-suppressor gene CHD5. Our findings support recent data, suggesting that the 1p36 region plays an important role in endometrios.
22855185 Decreased expression of chromodomain helicase DNA-binding protein 5 is associated with primary gallbladder carcinoma
22569290 study concludes that down-regulation of CHD5, mediated at least in part by promoter methylation, contributes to the development and progression of human breast cancer
22328561 Studies identified three genes, CHD5, PAFAH1B1, and NME1, strongly associated with patient outcome.
22294723 We conclude that (i) somatically acquired CHD5 mutations are rare in primary NBs, so inactivation probably occurs by deletion and epigenetic silencing.
22235338 the association of between miR-211-regulated CHD5 expression and CHD5 function in colorectal tumorigenesis
22186629 CHD5 is a potential tumor suppressor gene that is inactivated via an epigenetic mechanism in lung cancer.
21860208 CHD5 is downregulated in a certain number of ovarian cancers and appears to be an adverse predictor candidate of ovarian cancer disease-free and total survival.
21636313 data suggest that CHD5 is a tumor suppressor gene that is epigenetically downregulated in laryngeal squamous cell carcinoma.
21250965 As only one of the 47 families studied has the CHD5 rs7513548 SNP variant, it appears to be a rare event and further screening of melanoma families is required to confirm whether or not CHD5 is involved in melanoma pathogenesis.
20950435 Data show a strong association of CHD5 expression with favorable prognostic variables (age at diagnosis <12 months, low clinical stage, and favorable histology), overall survival and event-free survival.
19840376 CHD5 is a tumor suppressor gene epigenetically down-regulated in gastric cancer
18953434 study demonstrated the existence of somatic mutations and methylation of CHD5 in primary epithelial ovarian cancers; CHD5 may play a role as a tumor suppressor gene in ovarian cancer
18698156 the DNA methylation profiles of CHD family members (CHD1-9) in different tumor types.
18577749 CHD5 is the strongest candidate tumor suppressor gene that is deleted from 1p36.31 in neuroblastomas, and inactivation of the second allele may occur by an epigenetic mechanism.
18413720 A recent functional study identified chromodomain helicase DNA-binding protein 5 (CHD5) as a novel tumor suppressor mapping to 1p36. [REVIEW]
17289567 Study demonstrates that Chd5 functions as a tumor suppressor in vivo and implicates deletion of CHD5 in human cancer.
12592387 CDH5 may play a role in the development of the nervous system, and it may also play a role in the pathogenesis of neural tumors.

AA Sequence

MRGPVGTEEELPRLFAEEMENEDEMSEEEDGGLEAFDDFFPVEPVSLPKKKKPKKLKENKCKGKRKKKEG      1 - 70
SNDELSENEEDLEEKSESEGSDYSPNKKKKKKLKDKKEKKAKRKKKDEDEDDNDDGCLKEPKSSGQLMAE     71 - 140
WGLDDVDYLFSEEDYHTLTNYKAFSQFLRPLIAKKNPKIPMSKMMTVLGAKWREFSANNPFKGSSAAAAA    141 - 210
AAVAAAVETVTISPPLAVSPPQVPQPVPIRKAKTKEGKGPGVRKKIKGSKDGKKKGKGKKTAGLKFRFGG    211 - 280
ISNKRKKGSSSEEDEREESDFDSASIHSASVRSECSAALGKKSKRRRKKKRIDDGDGYETDHQDYCEVCQ    281 - 350
QGGEIILCDTCPRAYHLVCLDPELEKAPEGKWSCPHCEKEGIQWEPKDDDDEEEEGGCEEEEDDHMEFCR    351 - 420
VCKDGGELLCCDACPSSYHLHCLNPPLPEIPNGEWLCPRCTCPPLKGKVQRILHWRWTEPPAPFMVGLPG    421 - 490
PDVEPSLPPPKPLEGIPEREFFVKWAGLSYWHCSWVKELQLELYHTVMYRNYQRKNDMDEPPPFDYGSGD    491 - 560
EDGKSEKRKNKDPLYAKMEERFYRYGIKPEWMMIHRILNHSFDKKGDVHYLIKWKDLPYDQCTWEIDDID    561 - 630
IPYYDNLKQAYWGHRELMLGEDTRLPKRLLKKGKKLRDDKQEKPPDTPIVDPTVKFDKQPWYIDSTGGTL    631 - 700
HPYQLEGLNWLRFSWAQGTDTILADEMGLGKTVQTIVFLYSLYKEGHSKGPYLVSAPLSTIINWEREFEM    701 - 770
WAPDFYVVTYTGDKESRSVIRENEFSFEDNAIRSGKKVFRMKKEVQIKFHVLLTSYELITIDQAILGSIE    771 - 840
WACLVVDEAHRLKNNQSKFFRVLNSYKIDYKLLLTGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFAD    841 - 910
ISKEDQIKKLHDLLGPHMLRRLKADVFKNMPAKTELIVRVELSQMQKKYYKFILTRNFEALNSKGGGNQV    911 - 980
SLLNIMMDLKKCCNHPYLFPVAAVEAPVLPNGSYDGSSLVKSSGKLMLLQKMLKKLRDEGHRVLIFSQMT    981 - 1050
KMLDLLEDFLEYEGYKYERIDGGITGGLRQEAIDRFNAPGAQQFCFLLSTRAGGLGINLATADTVIIYDS   1051 - 1120
DWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKRKMMLTHLVVRPGLGSKSGSMTKQELD   1121 - 1190
DILKFGTEELFKDDVEGMMSQGQRPVTPIPDVQSSKGGNLAASAKKKHGSTPPGDNKDVEDSSVIHYDDA   1191 - 1260
AISKLLDRNQDATDDTELQNMNEYLSSFKVAQYVVREEDGVEEVEREIIKQEENVDPDYWEKLLRHHYEQ   1261 - 1330
QQEDLARNLGKGKRIRKQVNYNDASQEDQEWQDELSDNQSEYSIGSEDEDEDFEERPEGQSGRRQSRRQL   1331 - 1400
KSDRDKPLPPLLARVGGNIEVLGFNARQRKAFLNAIMRWGMPPQDAFNSHWLVRDLRGKSEKEFRAYVSL   1401 - 1470
FMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMSLVRKKVQEFEHVNGKYSTPDLIPEGPEGKKSG   1471 - 1540
EVISSDPNTPVPASPAHLLPAPLGLPDKMEAQLGYMDEKDPGAQKPRQPLEVQALPAALDRVESEDKHES   1541 - 1610
PASKERAREERPEETEKAPPSPEQLPREEVLPEKEKILDKLELSLIHSRGDSSELRPDDTKAEEKEPIET   1611 - 1680
QQNGDKEEDDEGKKEDKKGKFKFMFNIADGGFTELHTLWQNEERAAVSSGKIYDIWHRRHDYWLLAGIVT   1681 - 1750
HGYARWQDIQNDPRYMILNEPFKSEVHKGNYLEMKNKFLARRFKLLEQALVIEEQLRRAAYLNMTQDPNH   1751 - 1820
PAMALNARLAEVECLAESHQHLSKESLAGNKPANAVLHKVLNQLEELLSDMKADVTRLPSMLSRIPPVAA   1821 - 1890
RLQMSERSILSRLTNRAGDPTIQQGAFGSSQMYSNNFGPNFRGPGPGGIVNYNQMPLGPYVTDI         1891 - 1954
//

Text Mined References (40)

PMID Year Title
26753653 Influence of colorectal cancer tumor suppressor gene CHD5 methylation on its clinical and pathological characteristics.
26517514 2015 Mutual regulation between CHD5 and EZH2 in hepatocellular carcinoma.
25247294 2014 The chromatin remodeling factor CHD5 is a transcriptional repressor of WEE1.
24923445 2014 The tumor suppressor chromodomain helicase DNA-binding protein 5 (CHD5) remodels nucleosomes by unwrapping.
24529164 2014 CHD5 a tumour suppressor is epigenetically silenced in hepatocellular carcinoma.
24454811 2014 Silencing of CHD5 gene by promoter methylation in leukemia.
24276239 2014 Low CHD5 expression activates the DNA damage response and predicts poor outcome in patients undergoing adjuvant therapy for resected pancreatic cancer.
24243398 2014 Epigenetic silencing of CHD5, a novel tumor-suppressor gene, occurs in early colorectal cancer stages.
23948251 2013 CHD5 is required for neurogenesis and has a dual role in facilitating gene expression and polycomb gene repression.
23707602 2013 Downregulation of chromatin remodeling factor CHD5 is associated with a poor prognosis in human glioma.
23168260 2012 JMJD2A promotes cellular transformation by blocking cellular senescence through transcriptional repression of the tumor suppressor CHD5.
22910690 2012 Analysis of common variations in tumor-suppressor genes on chr1p36 among Caucasian women with endometriosis.
22855185 2013 Decreased expression of chromodomain helicase DNA-binding protein 5 is an unfavorable prognostic marker in patients with primary gallbladder carcinoma.
22569290 2012 Chromodomain helicase DNA binding protein 5 plays a tumor suppressor role in human breast cancer.
22328561 2012 A three-gene expression signature model for risk stratification of patients with neuroblastoma.
22294723 2012 Mechanisms of CHD5 Inactivation in neuroblastomas.
22235338 2012 MicroRNA-211 expression promotes colorectal cancer cell growth in vitro and in vivo by targeting tumor suppressor CHD5.
22186629 2012 CHD5, a tumor suppressor that is epigenetically silenced in lung cancer.
21931736 2011 CHD5, a brain-specific paralog of Mi2 chromatin remodeling enzymes, regulates expression of neuronal genes.
21860208 2011 CHD5 Downregulation Associated with Poor Prognosis in Epithelial Ovarian Cancer.
21636313 2011 The involvement of CHD5 hypermethylation in laryngeal squamous cell carcinoma.
21250965 2011 Preliminary evidence for involvement of the tumour suppressor gene CHD5 in a family with cutaneous melanoma.
20950435 2010 Expression of the neuron-specific protein CHD5 is an independent marker of outcome in neuroblastoma.
19946888 2010 Defining the membrane proteome of NK cells.
19840376 2009 CHD5 is down-regulated through promoter hypermethylation in gastric cancer.
18953434 2008 Mutation and methylation analysis of the chromodomain-helicase-DNA binding 5 gene in ovarian cancer.
18698156 Chromatin remodeling factor CHD5 is silenced by promoter CpG island hypermethylation in human cancer.
18577749 2008 CHD5, a tumor suppressor gene deleted from 1p36.31 in neuroblastomas.
18413720 2008 The quest for the 1p36 tumor suppressor.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17289567 2007 CHD5 is a tumor suppressor at human 1p36.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12592387 2003 CHD5, a new member of the chromodomain gene family, is preferentially expressed in the nervous system.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
10718198 2000 Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.
9455484 1997 Characterization of cDNA clones in size-fractionated cDNA libraries from human brain.