Property Summary

NCBI Gene PubMed Count 63
PubMed Score 145.80
PubTator Score 60.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Rheumatoid Arthritis 1.400 2.5e-03
malignant mesothelioma 1.200 2.6e-06
psoriasis 1.400 2.8e-03
osteosarcoma 1.947 6.2e-05
astrocytoma 1.400 6.5e-04
glioblastoma 1.300 4.7e-06
medulloblastoma 1.100 1.1e-03
medulloblastoma, large-cell 1.800 6.3e-05
primitive neuroectodermal tumor 1.200 2.4e-04
lung adenocarcinoma 1.317 5.8e-08
ovarian cancer 1.500 3.8e-07

 GWAS Trait (1)

Gene RIF (21)

PMID Text
26827827 Specifically, methyl-CpG-binding domain protein 2 (MBD2) is revealed to be recruited to DNA damage sites after laser microirradiation, which was mediated through MBD domain and MBD2 C-terminus.
26565020 these data build on our understanding of how CHD4-NuRD acts to regulate gene expression and participates in the DNA-damage response.
26546801 Acetyltransferase p300 collaborates with chromodomain helicase DNA-binding protein 4 (CHD4) to facilitate DNA double-strand break repair
26296641 Also discovered a novel causative role for CHD4, a helicase involved in the histone deacetylase complex that is associated with poor clinical outcome.
26265695 CHD4 depletion modulates expression of acute myeloid leukemia cell genes that regulate tumor formation in vivo and colony formation in vitro.
25737278 CHD4 modulates therapeutic response in BRCA2 mutant cancer cells.
25407497 D140E SNP was associated with lung cancer, malignant lymphoma and rectum cancer and may interact with smoking habit to increase the risk.
24991957 Endogenous Mta1/2 forms a complex with chromodomain helicase (Chd)4, histone deacetylases (Hdac)1/2, RbAp46/48, and Mbd3 in rat cerebellum
23708667 CHD4 and HDAC1 occupy the promoters of several of these hypermethylated tumor suppressor genes and physically and functionally interact to maintain their silencing.
23071088 repressive functions of MBD2-containing NuRD complexes are dependent on cooperative interactions between the major domains of CHD4 with histones and DNA and on binding of methylated DNA by MBD2
22749909 Concerted action of the PHD, chromo and motor domains regulates the human chromatin remodelling ATPase CHD4
22575888 a three-dimensional structural model describing the overall shape and domain interactions of CHD4 and discuss the relevance of these for regulating the remodeling of chromatin by the NuRD complex.
22302795 Chd4 is necessary to guide proper terminal differentiation of Schwann cells; the nucleosome remodeling and deacetylase (NURD) complex is a requisite factor in timely and stable peripheral chromatin remodeling.
21278251 CHD4 could bind to two H3 N-terminal tails on the same nucleosome or on two separate nucleosomes simultaneously, presenting exciting implications for the mechanism by which CHD4 and the NuRD complex could direct chromatin remodeling.
19624289 The PHD2 finger plays a role in targeting of the CHD4/NuRD complex to chromatin.
19296121 Data show that Mi-2/NuRD constitutes an enzymatic component of a pathway for assembly and maturation of chromatin utilized by rapidly proliferating lymphoid cells for replication of constitutive heterochromatin.
19158090 PU.1 directs Mi2beta to erase an established DNase I-hypersensitive site, in an ATP-dependent reaction subsequent to PU.1 binding to chromatin, whereas ACF will not support erasure
17694084 The known subunits of the Mi-2/NuRD complex , their connections to signaling networks, and their association with cancer are reviewed.
17626165 Pericentrin forms complexes with CHD3 and CHD4, but a distinct CHD3-pericentrin complex is required for centrosomal anchoring of pericentrin/gamma-tubulin and for centrosome integrity.
16186106 Mi-2beta and RFP, known to be involved in transcriptional repression in the nucleus, co-localize with MCRS1 in the nucleolus and appear to activate the rRNA transcription.
14530259 the amino-terminal and carboxyl-terminal regions of Mi-2 beta have distinct transcriptional activities and bind to BRG1 and the RET finger protein, forming a multiprotein supercomplex involved in transcriptional regulation.

AA Sequence

MASGLGSPSPCSAGSEEEDMDALLNNSLPPPHPENEEDPEEDLSETETPKLKKKKKPKKPRDPKIPKSKR      1 - 70
QKKERMLLCRQLGDSSGEGPEFVEEEEEVALRSDSEGSDYTPGKKKKKKLGPKKEKKSKSKRKEEEEEED     71 - 140
DDDDSKEPKSSAQLLEDWGMEDIDHVFSEEDYRTLTNYKAFSQFVRPLIAAKNPKIAVSKMMMVLGAKWR    141 - 210
EFSTNNPFKGSSGASVAAAAAAAVAVVESMVTATEVAPPPPPVEVPIRKAKTKEGKGPNARRKPKGSPRV    211 - 280
PDAKKPKPKKVAPLKIKLGGFGSKRKRSSSEDDDLDVESDFDDASINSYSVSDGSTSRSSRSRKKLRTTK    281 - 350
KKKKGEEEVTAVDGYETDHQDYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGKWSCPHCEKEGIQ    351 - 420
WEAKEDNSEGEEILEEVGGDLEEEDDHHMEFCRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLC    421 - 490
PRCTCPALKGKVQKILIWKWGQPPSPTPVPRPPDADPNTPSPKPLEGRPERQFFVKWQGMSYWHCSWVSE    491 - 560
LQLELHCQVMFRNYQRKNDMDEPPSGDFGGDEEKSRKRKNKDPKFAEMEERFYRYGIKPEWMMIHRILNH    561 - 630
SVDKKGHVHYLIKWRDLPYDQASWESEDVEIQDYDLFKQSYWNHRELMRGEEGRPGKKLKKVKLRKLERP    631 - 700
PETPTVDPTVKYERQPEYLDATGGTLHPYQMEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYK    701 - 770
EGHSKGPFLVSAPLSTIINWEREFEMWAPDMYVVTYVGDKDSRAIIRENEFSFEDNAIRGGKKASRMKKE    771 - 840
ASVKFHVLLTSYELITIDMAILGSIDWACLIVDEAHRLKNNQSKFFRVLNGYSLQHKLLLTGTPLQNNLE    841 - 910
ELFHLLNFLTPERFHNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKNMPSKTELIVRVELSP    911 - 980
MQKKYYKYILTRNFEALNARGGGNQVSLLNVVMDLKKCCNHPYLFPVAAMEAPKMPNGMYDGSALIRASG    981 - 1050
KLLLLQKMLKNLKEGGHRVLIFSQMTKMLDLLEDFLEHEGYKYERIDGGITGNMRQEAIDRFNAPGAQQF   1051 - 1120
CFLLSTRAGGLGINLATADTVIIYDSDWNPHNDIQAFSRAHRIGQNKKVMIYRFVTRASVEERITQVAKK   1121 - 1190
KMMLTHLVVRPGLGSKTGSMSKQELDDILKFGTEELFKDEATDGGGDNKEGEDSSVIHYDDKAIERLLDR   1191 - 1260
NQDETEDTELQGMNEYLSSFKVAQYVVREEEMGEEEEVEREIIKQEESVDPDYWEKLLRHHYEQQQEDLA   1261 - 1330
RNLGKGKRIRKQVNYNDGSQEDRDWQDDQSDNQSDYSVASEEGDEDFDERSEAPRRPSRKGLRNDKDKPL   1331 - 1400
PPLLARVGGNIEVLGFNARQRKAFLNAIMRYGMPPQDAFTTQWLVRDLRGKSEKEFKAYVSLFMRHLCEP   1401 - 1470
GADGAETFADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVNGRWSMPELAEVEENKKMSQPGSPSPKT   1471 - 1540
PTPSTPGDTQPNTPAPVPPAEDGIKIEENSLKEEESIEGEKEVKSTAPETAIECTQAPAPASEDEKVVVE   1541 - 1610
PPEGEEKVEKAEVKERTEEPMETEPKGAADVEKVEEKSAIDLTPIVVEDKEEKKEEEEKKEVMLQNGETP   1611 - 1680
KDLNDEKQKKNIKQRFMFNIADGGFTELHSLWQNEERAATVTKKTYEIWHRRHDYWLLAGIINHGYARWQ   1681 - 1750
DIQNDPRYAILNEPFKGEMNRGNFLEIKNKFLARRFKLLEQALVIEEQLRRAAYLNMSEDPSHPSMALNT   1751 - 1820
RFAEVECLAESHQHLSKESMAGNKPANAVLHKVLKQLEELLSDMKADVTRLPATIARIPPVAVRLQMSER   1821 - 1890
NILSRLANRAPEPTPQQVAQQQ                                                   1891 - 1912
//

Text Mined References (82)

PMID Year Title
27616479 2016 De Novo Mutations in CHD4, an ATP-Dependent Chromatin Remodeler Gene, Cause an Intellectual Disability Syndrome with Distinctive Dysmorphisms.
27235397 2016 CHD4 Is a Peripheral Component of the Nucleosome Remodeling and Deacetylase Complex.
26827827 2016 iTRAQ-based chromatin proteomic screen reveals CHD4-dependent recruitment of MBD2 to sites of DNA damage.
26565020 2016 The N-terminal Region of Chromodomain Helicase DNA-binding Protein 4 (CHD4) Is Essential for Activity and Contains a High Mobility Group (HMG) Box-like-domain That Can Bind Poly(ADP-ribose).
26546801 2016 Acetyltransferase p300 collaborates with chromodomain helicase DNA-binding protein 4 (CHD4) to facilitate DNA double-strand break repair.
26296641 2015 Predicting Response to Histone Deacetylase Inhibitors Using High-Throughput Genomics.
26265695 2015 Depletion of the chromatin remodeler CHD4 sensitizes AML blasts to genotoxic agents and reduces tumor formation.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25737278 2015 Resistance to therapy in BRCA2 mutant cells due to loss of the nucleosome remodeling factor CHD4.
25407497 2015 Association of the chromodomain helicase DNA-binding protein 4 (CHD4) missense variation p.D140E with cancer: potential interaction with smoking.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24991957 2014 Promoter decommissioning by the NuRD chromatin remodeling complex triggers synaptic connectivity in the mammalian brain.
24576085 2014 Inhibition of histone binding by supramolecular hosts.
24440720 2014 ZFHX4 interacts with the NuRD core member CHD4 and regulates the glioblastoma tumor-initiating cell state.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23954449 2013 CHD chromatin remodelling enzymes and the DNA damage response.
23752268 2013 The functional interactome landscape of the human histone deacetylase family.
23708667 2014 The NuRD complex cooperates with DNMTs to maintain silencing of key colorectal tumor suppressor genes.
23697937 2013 CHD4 in the DNA-damage response and cell cycle progression: not so NuRDy now.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23149945 2013 Senataxin, defective in the neurodegenerative disorder ataxia with oculomotor apraxia 2, lies at the interface of transcription and the DNA damage response.
23104009 2012 Exome sequencing of serous endometrial tumors identifies recurrent somatic mutations in chromatin-remodeling and ubiquitin ligase complex genes.
23071088 2012 MBD2 and multiple domains of CHD4 are required for transcriptional repression by Mi-2/NuRD complexes.
23049088 2012 A genome-wide association study provides evidence for association of chromosome 8p23 (MYP10) and 10q21.1 (MYP15) with high myopia in the French Population.
22926524 2013 RBB, a novel transcription repressor, represses the transcription of HDM2 oncogene.
22749909 2012 Concerted action of the PHD, chromo and motor domains regulates the human chromatin remodelling ATPase CHD4.
22720776 2012 PHF6 interacts with the nucleosome remodeling and deacetylation (NuRD) complex.
22575888 2012 The PHD and chromo domains regulate the ATPase activity of the human chromatin remodeler CHD4.
22302795 2012 The nucleosome remodeling and deacetylase chromatin remodeling (NuRD) complex is required for peripheral nerve myelination.
21555454 2011 The Brd4 extraterminal domain confers transcription activation independent of pTEFb by recruiting multiple proteins, including NSD3.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21278251 2011 Plant homeodomain (PHD) fingers of CHD4 are histone H3-binding modules with preference for unmodified H3K4 and methylated H3K9.
21269460 2011 Initial characterization of the human central proteome.
21258344 2011 Chemoproteomics profiling of HDAC inhibitors reveals selective targeting of HDAC complexes.
20693977 2010 Regulation of DNA-damage responses and cell-cycle progression by the chromatin remodelling factor CHD4.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19644445 2009 ZIP: a novel transcription repressor, represses EGFR oncogene and suppresses breast carcinogenesis.
19624289 2009 Binding of the CHD4 PHD2 finger to histone H3 is modulated by covalent modifications.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19296121 2009 The Mi-2/NuRD complex associates with pericentromeric heterochromatin during S phase in rapidly proliferating lymphoid cells.
19158090 2009 Mi2beta shows chromatin enzyme specificity by erasing a DNase I-hypersensitive site established by ACF.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17694084 2007 The human Mi-2/NuRD complex and gene regulation.
17626165 2007 Chromatin remodeling proteins interact with pericentrin to regulate centrosome integrity.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17314511 2007 Large-scale identification of c-MYC-associated proteins using a combined TAP/MudPIT approach.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16541075 2006 The finished DNA sequence of human chromosome 12.
16217013 2005 Heterogeneous nuclear ribonucleoprotein C1/C2, MeCP1, and SWI/SNF form a chromatin remodeling complex at the beta-globin locus control region.
16186106 2005 Microspherule protein 1, Mi-2beta, and RET finger protein associate in the nucleolus and up-regulate ribosomal gene transcription.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15454082 2004 MTA3 and the Mi-2/NuRD complex regulate cell fate during B lymphocyte differentiation.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15231747 2004 A protein interaction framework for human mRNA degradation.
15189737 2004 The chromatin remodeler Mi-2beta is required for CD4 expression and T cell development.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14530259 2003 Mi-2 beta associates with BRG1 and RET finger protein at the distinct regions with transcriptional activating and repressing abilities.
12842043 2003 Engineering a protein scaffold from a PHD finger.
12493763 2003 A candidate X-linked mental retardation gene is a component of a new family of histone deacetylase-containing complexes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12124384 2002 The mCpG-binding domain of human MBD3 does not bind to mCpG but interacts with NuRD/Mi2 components HDAC1 and MTA2.
12015313 2002 A molecular dissection of the repression circuitry of Ikaros.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11102443 2001 Stable histone deacetylase complexes distinguished by the presence of SANT domain proteins CoREST/kiaa0071 and Mta-L1.
10545197 1999 Molecular association between ATR and two components of the nucleosome remodeling and deacetylating complex, HDAC2 and CHD4.
10444591 1999 Analysis of the NuRD subunits reveals a histone deacetylase core complex and a connection with DNA methylation.
10228159 1999 The E7 oncoprotein associates with Mi2 and histone deacetylase activity to promote cell growth.
10220385 1999 Three proteins define a class of human histone deacetylases related to yeast Hda1p.
10204490 1999 Ikaros DNA-binding proteins direct formation of chromatin remodeling complexes in lymphocytes.
9804427 1998 Chromatin deacetylation by an ATP-dependent nucleosome remodelling complex.
9790534 1998 The dermatomyositis-specific autoantigen Mi2 is a component of a complex containing histone deacetylase and nucleosome remodeling activities.
9326634 1997 Characterization of the CHD family of proteins.
8843877 1996 Two forms of the major antigenic protein of the dermatomyositis-specific Mi-2 autoantigen.
7575689 1995 The major dermatomyositis-specific Mi-2 autoantigen is a presumed helicase involved in transcriptional activation.
7560064 1995 Molecular analysis of a major antigenic region of the 240-kD protein of Mi-2 autoantigen.