Property Summary

NCBI Gene PubMed Count 40
PubMed Score 82.77
PubTator Score 65.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Sezary Syndrome 26
Disease Target Count P-value
posterior fossa group B ependymoma 1530 7.8e-10
adult high grade glioma 2148 5.6e-05
osteosarcoma 7933 1.3e-04
glioblastoma 5572 2.0e-03
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.857 1.3e-04
posterior fossa group B ependymoma -1.600 7.8e-10
glioblastoma -1.500 2.0e-03
adult high grade glioma -1.500 5.6e-05

 GWAS Trait (2)

Gene RIF (9)

PMID Text
26551667 Mutations in CHD3 gene is associated with cutaneous T cell lymphoma and Sezary syndrome.
26362536 HIV-1 Gag interacts with CHD3 as demonstrated by proximity dependent biotinylation proteomics
25533843 CHD3.1 and ACF1-SNF2H display counteractive activities but similar histone affinities.
25213355 CHD3 was confirmed to interact with NES1 in NS2, and a disruption to this interaction by mutation in NES1 significantly delayed viral vRNPs export and viral propagation.
24425734 In this study, the chromatin remodeler chromodomain helicase DNA binding (CHD3) protein is identified as an important component of the initial repression of the herpesvirus genome.
22140357 HIV-1 Gag interacts with CHD3 as demonstrated by proximity dependent biotinylation proteomics
18922793 UV radiation regulates Mi-2 through protein translation and stability
17626165 Pericentrin forms complexes with CHD3 and CHD4, but a distinct CHD3-pericentrin complex is required for centrosomal anchoring of pericentrin/gamma-tubulin and for centrosome integrity.
17489097 effect of progressive C-terminal deletions of CHD3, which indicated that sequences required for repression of PS1 lie between amino acids 1955 and 1877

AA Sequence

MKAADTVILWARSKNDQLRISFPPGLCWGDRMPDKDDIRLLPSALGVKKRKRGPKKQKENKPGKPRKRKK      1 - 70
RDSEEEFGSERDEYREKSESGGSEYGTGPGRKRRRKHREKKEKKTKRRKKGEGDGGQKQVEQKSSATLLL     71 - 140
TWGLEDVEHVFSEEDYHTLTNYKAFSQFMRPLIAKKNPKIPMSKMMTILGAKWREFSANNPFKGSAAAVA    141 - 210
AAAAAAAAAVAEQVSAAVSSATPIAPSGPPALPPPPAADIQPPPIRRAKTKEGKGPGHKRRSKSPRVPDG    211 - 280
RKKLRGKKMAPLKIKLGLLGGKRKKGGSYVFQSDEGPEPEAEESDLDSGSVHSASGRPDGPVRTKKLKRG    281 - 350
RPGRKKKKVLGCPAVAGEEEVDGYETDHQDYCEVCQQGGEIILCDTCPRAYHLVCLDPELDRAPEGKWSC    351 - 420
PHCEKEGVQWEAKEEEEEYEEEGEEEGEKEEEDDHMEYCRVCKDGGELLCCDACISSYHIHCLNPPLPDI    421 - 490
PNGEWLCPRCTCPVLKGRVQKILHWRWGEPPVAVPAPQQADGNPDVPPPRPLQGRSEREFFVKWVGLSYW    491 - 560
HCSWAKELQLEIFHLVMYRNYQRKNDMDEPPPLDYGSGEDDGKSDKRKVKDPHYAEMEEKYYRFGIKPEW    561 - 630
MTVHRIINHSVDKKGNYHYLVKWRDLPYDQSTWEEDEMNIPEYEEHKQSYWRHRELIMGEDPAQPRKYKK    631 - 700
KKKELQGDGPPSSPTNDPTVKYETQPRFITATGGTLHMYQLEGLNWLRFSWAQGTDTILADEMGLGKTIQ    701 - 770
TIVFLYSLYKEGHTKGPFLVSAPLSTIINWEREFQMWAPKFYVVTYTGDKDSRAIIRENEFSFEDNAIKG    771 - 840
GKKAFKMKREAQVKFHVLLTSYELITIDQAALGSIRWACLVVDEAHRLKNNQSKFFRVLNGYKIDHKLLL    841 - 910
TGTPLQNNLEELFHLLNFLTPERFNNLEGFLEEFADISKEDQIKKLHDLLGPHMLRRLKADVFKNMPAKT    911 - 980
ELIVRVELSPMQKKYYKYILTRNFEALNSRGGGNQVSLLNIMMDLKKCCNHPYLFPVAAMESPKLPSGAY    981 - 1050
EGGALIKSSGKLMLLQKMLRKLKEQGHRVLIFSQMTKMLDLLEDFLDYEGYKYERIDGGITGALRQEAID   1051 - 1120
RFNAPGAQQFCFLLSTRAGGLGINLATADTVIIFDSDWNPHNDIQAFSRAHRIGQANKVMIYRFVTRASV   1121 - 1190
EERITQVAKRKMMLTHLVVRPGLGSKAGSMSKQELDDILKFGTEELFKDENEGENKEEDSSVIHYDNEAI   1191 - 1260
ARLLDRNQDATEDTDVQNMNEYLSSFKVAQYVVREEDKIEEIEREIIKQEENVDPDYWEKLLRHHYEQQQ   1261 - 1330
EDLARNLGKGKRVRKQVNYNDAAQEDQDNQSEYSVGSEEEDEDFDERPEGRRQSKRQLRNEKDKPLPPLL   1331 - 1400
ARVGGNIEVLGFNTRQRKAFLNAVMRWGMPPQDAFTTQWLVRDLRGKTEKEFKAYVSLFMRHLCEPGADG   1401 - 1470
SETFADGVPREGLSRQQVLTRIGVMSLVKKKVQEFEHINGRWSMPELMPDPSADSKRSSRASSPTKTSPT   1471 - 1540
TPEASATNSPCTSKPATPAPSEKGEGIRTPLEKEEAENQEEKPEKNSRIGEKMETEADAPSPAPSLGERL   1541 - 1610
EPRKIPLEDEVPGVPGEMEPEPGYRGDREKSATESTPGERGEEKPLDGQEHRERPEGETGDLGKREDVKG   1611 - 1680
DRELRPGPRDEPRSNGRREEKTEKPRFMFNIADGGFTELHTLWQNEERAAISSGKLNEIWHRRHDYWLLA   1681 - 1750
GIVLHGYARWQDIQNDAQFAIINEPFKTEANKGNFLEMKNKFLARRFKLLEQALVIEEQLRRAAYLNLSQ   1751 - 1820
EPAHPAMALHARFAEAECLAESHQHLSKESLAGNKPANAVLHKVLNQLEELLSDMKADVTRLPATLSRIP   1821 - 1890
PIAARLQMSERSILSRLASKGTEPHPTPAYPPGPYATPPGYGAAFSAAPVGALAAAGANYSQMPAGSFIT   1891 - 1960
AATNGPPVLVKKEKEMVGALVSDGLDRKEPRAGEVICIDD                                 1961 - 2000
//

Text Mined References (51)

PMID Year Title
26551667 2015 The mutational landscape of cutaneous T cell lymphoma and Sézary syndrome.
25533843 2014 Opposing ISWI- and CHD-class chromatin remodeling activities orchestrate heterochromatic DNA repair.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25213355 2015 CHD3 facilitates vRNP nuclear export by interacting with NES1 of influenza A virus NS2.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24425734 2014 Epigenetic repression of herpes simplex virus infection by the nucleosome remodeler CHD3.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22720776 2012 PHF6 interacts with the nucleosome remodeling and deacetylation (NuRD) complex.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
21269460 2011 Initial characterization of the human central proteome.
20676135 2010 Phosphorylated p68 RNA helicase activates Snail1 transcription by promoting HDAC1 dissociation from the Snail1 promoter.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19703393 2009 LSD1 is a subunit of the NuRD complex and targets the metastasis programs in breast cancer.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18922793 2008 UV radiation regulates Mi-2 through protein translation and stability.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17827154 2007 Differential distribution of unmodified and phosphorylated histone deacetylase 2 in chromatin.
17626165 2007 Chromatin remodeling proteins interact with pericentrin to regulate centrosome integrity.
17489097 2007 The C-terminal region of CHD3/ZFH interacts with the CIDD region of the Ets transcription factor ERM and represses transcription of the human presenilin 1 gene.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15635413 2005 Nucleolar proteome dynamics.
15383276 2004 A protein interaction network links GIT1, an enhancer of huntingtin aggregation, to Huntington's disease.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15020045 2004 Mi-2/NuRD: multiple complexes for many purposes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14609633 2003 Association of the nucleocapsid protein of the Seoul and Hantaan hantaviruses with small ubiquitin-like modifier-1-related molecules.
12705869 2003 MTA3, a Mi-2/NuRD complex subunit, regulates an invasive growth pathway in breast cancer.
12505151 2003 Characterization of a new family of proteins that interact with the C-terminal region of the chromatin-remodeling factor CHD-3.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12374985 2002 SATB1 targets chromatin remodelling to regulate genes over long distances.
11230151 2001 Targeting histone deacetylase complexes via KRAB-zinc finger proteins: the PHD and bromodomains of KAP-1 form a cooperative unit that recruits a novel isoform of the Mi-2alpha subunit of NuRD.
10961991 2000 Covalent modification of p73alpha by SUMO-1. Two-hybrid screening with p73 identifies novel SUMO-1-interacting proteins and a SUMO-1 interaction motif.
10662545 2000 Physical map of 17p13 and the genes adjacent to p53.
10471500 1999 Mi-2 complex couples DNA methylation to chromatin remodelling and histone deacetylation.
10204490 1999 Ikaros DNA-binding proteins direct formation of chromatin remodeling complexes in lymphocytes.
9921901 1998 CCG repeats in cDNAs from human brain.
9804427 1998 Chromatin deacetylation by an ATP-dependent nucleosome remodelling complex.
9688266 1998 Identification of a human 17p-located cDNA encoding a protein of the Snf2-like helicase family.
9326634 1997 Characterization of the CHD family of proteins.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8843877 1996 Two forms of the major antigenic protein of the dermatomyositis-specific Mi-2 autoantigen.
7575689 1995 The major dermatomyositis-specific Mi-2 autoantigen is a presumed helicase involved in transcriptional activation.
7560064 1995 Molecular analysis of a major antigenic region of the 240-kD protein of Mi-2 autoantigen.
1639417 1992 Expressed sequence tags and chromosomal localization of cDNA clones from a subtracted retinal pigment epithelium library.