Property Summary

NCBI Gene PubMed Count 34
PubMed Score 165.81
PubTator Score 88.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
psoriasis -1.700 7.6e-05
osteosarcoma -1.197 7.0e-03
astrocytoma 1.100 8.0e-03
atypical teratoid / rhabdoid tumor 1.300 1.2e-04
medulloblastoma, large-cell 1.700 1.9e-04
intraductal papillary-mucinous adenoma (... 1.400 6.9e-04
intraductal papillary-mucinous carcinoma... 1.200 4.1e-04
intraductal papillary-mucinous neoplasm ... 1.100 4.8e-03
lung cancer 2.200 4.5e-06
ovarian cancer 2.300 2.1e-07

Gene RIF (21)

PMID Text
26599012 This study identified CHD1L as a potential anti-metastasis target for therapeutic intervention in breast cancer.
26360781 Overexpression of CHD1L is positively associated with tumor metastasis of lung adenocarcinoma, and might serve as a novel prognostic biomarker and potential therapeutic target for patients.
25153161 Relative mRNA expression level of CHD1L was higher in breast cancer cell lines.
24359616 CHD1L is now considered to be a novel independent biomarker for progression, prognosis and survival in several solid tumors. [Review]
24258459 These results indicated that CHD1L could serve as a prognostic marker for gastric cancer
23926104 TRIM33 plays a role in PARP-dependent DNA damage response and regulates ALC1 activity by promoting its timely removal from sites of DNA damage.
23807680 Data indicate that chromodomain helicase/ATPase DNA-binding protein 1-like (CHD1L) might be an diagnostic and prognostic marker for bladder cancer (BC) patients.
23746766 CHD1L is the target oncogene within the 1q21 amplicon and plays a pivotal role in colorectal carcinoma pathogenesis.
23132853 the model that PAR present on PARylated PARP1 acts as an allosteric effector of ALC1 nucleosome remodeling activity.
23045548 data support a model in which poly(ADP-ribosyl)ation of DDB2 suppresses DDB2 ubiquitylation and outline a molecular mechanism for PARP1-mediated regulation of nucleotide excision repair through DDB2 stabilization and recruitment of the chromatin remodeler ALC1
23020525 positive expression of CHD1L protein is significantly correlated with the metastasis proceeding of ovarian carcinoma, and CHD1L protein expression, as examined by IHC, may act as a novel prognostic biomarker for patients with ovarian carcinoma.
22146311 Mutation in CHD1L is associated with congenital anomalies of the kidneys and urinary tract.
21953552 CHD1L/TCTP/Cdc25C/Cdk1 molecular pathway causes the malignant transformation of hepatocytes with the phenotypes of accelerated mitotic progression and the production of aneuploidy
21824431 1q21.1 copy number variant (CNV) results in newly identified function such as decatenation (chromatid untangling) checkpoint (DCC) activation in the case of CHD1l/ALC1 in lymphoblast cell lines.
21068133 Overexpression of CHD1L was significantly associated with tumour microsatellite formation, advanced tumour stage, overall survival time of patients who received transarterial chemoembolisation treatment and chemoresistance in hepatocellular carcinoma.
20453000 Observational study of gene-disease association. (HuGE Navigator)
20335658 CHD1L promotes hepatocellular carcinoma progression and metastasis in mice and is associated with these processes in human patients.
19666485 Poly(ADP-ribosyl)ation directs recruitment and activation of the ATP-dependent chromatin remodeler ALC1
19666485 Alc1 is a chromatin remodeling enzyme activated by binding of its macrodomain to poly(ADP-ribosyl)ated Parp1. Alc1 is recruited to nucleosomes in vitro and to chromatin in cells when Parp1 catalyzes poly(ADP-ribose) synthesis at sites of DNA damage.
19661379 results define ALC1 as a DNA damage-response protein whose role in this process is sustained by its association with known DNA repair factors and its rapid poly(ADP-ribose)-dependent recruitment to DNA damage sites
18023026 ALC1 is the target oncogene within the chromosome 1q21 amplicon and plays a pivotal role in hepeatocellular carcinoma pathogenesis.

AA Sequence

MERAGATSRGGQAPGFLLRLHTEGRAEAARVQEQDLRQWGLTGIHLRSYQLEGVNWLAQRFHCQNGCILG      1 - 70
DEMGLGKTCQTIALFIYLAGRLNDEGPFLILCPLSVLSNWKEEMQRFAPGLSCVTYAGDKEERACLQQDL     71 - 140
KQESRFHVLLTTYEICLKDASFLKSFPWSVLVVDEAHRLKNQSSLLHKTLSEFSVVFSLLLTGTPIQNSL    141 - 210
QELYSLLSFVEPDLFSKEEVGDFIQRYQDIEKESESASELHKLLQPFLLRRVKAEVATELPKKTEVVIYH    211 - 280
GMSALQKKYYKAILMKDLDAFENETAKKVKLQNILSQLRKCVDHPYLFDGVEPEPFEVGDHLTEASGKLH    281 - 350
LLDKLLAFLYSGGHRVLLFSQMTQMLDILQDYMDYRGYSYERVDGSVRGEERHLAIKNFGQQPIFVFLLS    351 - 420
TRAGGVGMNLTAADTVIFVDSDFNPQNDLQAAARAHRIGQNKSVKVIRLIGRDTVEEIVYRKAASKLQLT    421 - 490
NMIIEGGHFTLGAQKPAADADLQLSEILKFGLDKLLASEGSTMDEIDLESILGETKDGQWVSDALPAAEG    491 - 560
GSRDQEEGKNHMYLFEGKDYSKEPSKEDRKSFEQLVNLQKTLLEKASQEGRSLRNKGSVLIPGLVEGSTK    561 - 630
RKRVLSPEELEDRQKKRQEAAAKRRRLIEEKKRQKEEAEHKKKMAWWESNNYQSFCLPSEESEPEDLENG    631 - 700
EESSAELDYQDPDATSLKYVSGDVTHPQAGAEDALIVHCVDDSGHWGRGGLFTALEKRSAEPRKIYELAG    701 - 770
KMKDLSLGGVLLFPVDDKESRNKGQDLLALIVAQHRDRSNVLSGIKMAALEEGLKKIFLAAKKKKASVHL    771 - 840
PRIGHATKGFNWYGTERLIRKHLAARGIPTYIYYFPRSKSAVLHAQSSSSSSRQLVP                 841 - 897
//

Text Mined References (43)

PMID Year Title
26599012 2015 Chromodomain Helicase/ATPase DNA-Binding Protein 1-Like Gene (CHD1L) Expression and Implications for Invasion and Metastasis of Breast Cancer.
26360781 2015 Overexpression of CHD1L is positively associated with metastasis of lung adenocarcinoma and predicts patients poor survival.
25240745 2014 A genome-wide association study in the genetic analysis of idiopathic thrombophilia project suggests sex-specific regulation of mitochondrial DNA levels.
25153161 2014 Presence of CHD1L over-expression is associated with aggressive tumor biology and is a novel prognostic biomarker for patient survival in human breast cancer.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24359616 2013 CHD1L: a novel oncogene.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24258459 2014 CHD1L is a novel independent prognostic factor for gastric cancer.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23926104 2013 Tripartite Motif-containing 33 (TRIM33) protein functions in the poly(ADP-ribose) polymerase (PARP)-dependent DNA damage response through interaction with Amplified in Liver Cancer 1 (ALC1) protein.
23807680 2013 Expression of CHD1L in bladder cancer and its influence on prognosis and survival.
23746766 2013 CHD1L promotes tumor progression and predicts survival in colorectal carcinoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23132853 2012 Activation of the SNF2 family ATPase ALC1 by poly(ADP-ribose) in a stable ALC1·PARP1·nucleosome intermediate.
23045548 2012 PARP1 promotes nucleotide excision repair through DDB2 stabilization and recruitment of ALC1.
23020525 2012 CHD1L protein is overexpressed in human ovarian carcinomas and is a novel predictive biomarker for patients survival.
22146311 2012 CHD1L: a new candidate gene for congenital anomalies of the kidneys and urinary tract (CAKUT).
21953552 2012 Translationally controlled tumor protein induces mitotic defects and chromosome missegregation in hepatocellular carcinoma development.
21824431 2011 Understanding the impact of 1q21.1 copy number variant.
21269460 2011 Initial characterization of the human central proteome.
21068133 2011 Clinical significance of CHD1L in hepatocellular carcinoma and therapeutic potentials of virus-mediated CHD1L depletion.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20335658 2010 CHD1L promotes hepatocellular carcinoma progression and metastasis in mice and is associated with these processes in human patients.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19666485 2009 Poly(ADP-ribosyl)ation directs recruitment and activation of an ATP-dependent chromatin remodeler.
19661379 2009 Poly(ADP-ribose)-dependent regulation of DNA repair by the chromatin remodeling enzyme ALC1.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18464913 2008 A genome-wide association study identifies protein quantitative trait loci (pQTLs).
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18023026 2008 Isolation and characterization of a novel oncogene, amplified in liver cancer 1, within a commonly amplified region at 1q21 in hepatocellular carcinoma.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
9653160 1998 Identification of genes expressed in human CD34(+) hematopoietic stem/progenitor cells by expressed sequence tags and efficient full-length cDNA cloning.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8076819 1994 The addition of 5'-coding information to a 3'-directed cDNA library improves analysis of gene expression.