Property Summary

NCBI Gene PubMed Count 1
PubMed Score 31.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

AA Sequence

MPRGSRSRTSRMAPPASRAPQMRAAPRPAPVAQPPAAAPPSAVGSSAAAPRQPGLMAQMATTAAGVAVGS      1 - 70
AVGHTQGHAVTGGFSGGSNAEPARPDIAYQEPQGTQPAQQQQPCFYGIKQFLECAQNQGDIKLCEDFSKV     71 - 140
LKQCRLAKGLA                                                               141 - 151
//

Text Mined References (2)

PMID Year Title
26186194 2015 The BioPlex Network: A Systematic Exploration of the Human Interactome.
15164053 2004 DNA sequence and analysis of human chromosome 9.