Property Summary

NCBI Gene PubMed Count 52
PubMed Score 37.92
PubTator Score 221.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma 1.400 2.1e-06
osteosarcoma -1.587 1.7e-05
group 3 medulloblastoma 1.900 1.8e-05
atypical teratoid/rhabdoid tumor 1.300 1.4e-06
medulloblastoma, large-cell 1.300 1.2e-03
primitive neuroectodermal tumor 1.200 1.5e-02
non-small cell lung cancer 1.263 1.2e-15
lung cancer 1.500 9.6e-04
colon cancer 1.200 8.6e-04

Gene RIF (18)

PMID Text
26945061 These data suggest that CAF-1- and ASF1A-H3-H4-dependent deposition of the histone (H3-H4)2 tetramers is compatible with MMR and protects the discontinuous daughter strand from unnecessary degradation by MMR machinery.
26740175 Taken together, these results show that CHAF1A contributes to the proliferation of glioblastoma cells and may be developed as a de novo drug target and prognosis biomarker of glioblastoma.
25057015 Novel functions for a separable domain of the p150 protein, regulating protein and DNA interactions at the nucleolus.
24845563 The frequency of positive CHAF1A staining in primary tumor mucosa (45.8% of 203 samples) was significantly elevated compared to normal mucosa (18.7% of samples). Increased expression was associated with cancer stage, tumor invasion and histological grade.
24335960 Histone chaperone CHAF1A inhibits differentiation and promotes aggressive neuroblastoma.
22190034 HIV-1 gp120 is identified to have a physical interaction with chromatin assembly factor 1, subunit A (CHAF1A; CAF1B) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21445097 CAF1 was hijacked by IE2 to facilitate the replication of the HCMV genome, suggesting chromatin assembly plays an important role in herpesviral DNA synthesis, but also provide a model of the virus-induced chromatin instability through CAF1.
21282622 CAF-I-dependent control of degradation of the discontinuous strands during mismatch repair.
20800603 Observational study of gene-disease association. (HuGE Navigator)
19919826 these findings suggest an expanded role of p150 as a SUMO2/3-interacting factor, and raise the intriguing possibility that p150 plays a role in promoting delivery of SUMO2/3 or SUMO2/3-modified proteins (or both) on chromatin fibers during replication.
19822659 Data show that human CAF-1 (p150) contains two PCNA interaction peptides, and suggest that these peptides are part of the mechanism that enables CAF-1 to function behind replication forks without interfering with other PCNA-mediated processes.
19324875 p150 directly activates transcription, independently of its histone deposition function.
18854154 Knockdown of chromatin assembly factor 1, subunit A (CHAF1A) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18559551 rs9352 of CHAF1A was repeatedly includes (78% of the 200 bootstrap samples) in the best set of SNPs. CHAF1A may contribute to gliomagenesis.
18270339 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
17099699 ACF generates the characteristic 50- to 60-base-pair internucleosomal spacing in silent chromatin by kinetically discriminating against shorter linker DNAs
16826239 p150 was efficiently phosphorylated by Cdc7-Dbf4 kinase.
15067324 Altered mRNA expression is associated with prostate cancer recurrence.

AA Sequence

MLEELECGAPGARGAATAMDCKDRPAFPVKKLIQARLPFKRLNLVPKGKADDMSDDQGTSVQSKSPDLEA      1 - 70
SLDTLENNCHVGSDIDFRPKLVNGKGPLDNFLRNRIETSIGQSTVIIDLTEDSNEQPDSLVDHNKLNSEA     71 - 140
SPSREAINGQREDTGDQQGLLKAIQNDKLAFPGETLSDIPCKTEEEGVGCGGAGRRGDSQECSPRSCPEL    141 - 210
TSGPRMCPRKEQDSWSEAGGILFKGKVPMVVLQDILAVRPPQIKSLPATPQGKNMTPESEVLESFPEEDS    211 - 280
VLSHSSLSSPSSTSSPEGPPAPPKQHSSTSPFPTSTPLRRITKKFVKGSTEKNKLRLQRDQERLGKQLKL    281 - 350
RAEREEKEKLKEEAKRAKEEAKKKKEEEKELKEKERREKREKDEKEKAEKQRLKEERRKERQEALEAKLE    351 - 420
EKRKKEEEKRLREEEKRIKAEKAEITRFFQKPKTPQAPKTLAGSCGKFAPFEIKEHMVLAPRRRTAFHPD    421 - 490
LCSQLDQLLQQQSGEFSFLKDLKGRQPLRSGPTHVSTRNADIFNSDVVIVERGKGDGVPERRKFGRMKLL    491 - 560
QFCENHRPAYWGTWNKKTALIRARDPWAQDTKLLDYEVDSDEEWEEEEPGESLSHSEGDDDDDMGEDEDE    561 - 630
DDGFFVPHGYLSEDEGVTEECADPENHKVRQKLKAKEWDEFLAKGKRFRVLQPVKIGCVWAADRDCAGDD    631 - 700
LKVLQQFAACFLETLPAQEEQTPKASKRERRDEQILAQLLPLLHGNVNGSKVIIREFQEHCRRGLLSNHT    701 - 770
GSPRSPSTTYLHTPTPSEDAAIPSKSRLKRLISENSVYEKRPDFRMCWYVHPQVLQSFQQEHLPVPCQWS    771 - 840
YVTSVPSAPKEDSGSVPSTGPSQGTPISLKRKSAGSMCITQFMKKRRHDGQIGAEDMDGFQADTEEEEEE    841 - 910
EGDCMIVDVPDAAEVQAPCGAASGAGGGVGVDTGKATLTSSPLGAS                            911 - 956
//

Text Mined References (63)

PMID Year Title
26945061 2016 DNA Mismatch Repair Interacts with CAF-1- and ASF1A-H3-H4-dependent Histone (H3-H4)2 Tetramer Deposition.
26740175 2016 Over-expression of CHAF1A promotes cell proliferation and apoptosis resistance in glioblastoma cells via AKT/FOXO3a/Bim pathway.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25057015 2014 A separable domain of the p150 subunit of human chromatin assembly factor-1 promotes protein and chromosome associations with nucleoli.
24845563 2014 Up-regulation of CHAF1A, a poor prognostic factor, facilitates cell proliferation of colon cancer.
24335960 2014 Histone chaperone CHAF1A inhibits differentiation and promotes aggressive neuroblastoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21888893 2011 Analysis of the human HP1 interactome reveals novel binding partners.
21570500 The p150 subunit of the histone chaperone Caf-1 interacts with the transcriptional repressor Gfi1.
21445097 2011 Host-viral effects of chromatin assembly factor 1 interaction with HCMV IE2.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21282622 2011 CAF-I-dependent control of degradation of the discontinuous strands during mismatch repair.
21179005 2011 Asf1b, the necessary Asf1 isoform for proliferation, is predictive of outcome in breast cancer.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20562864 2010 Human POGZ modulates dissociation of HP1alpha from mitotic chromosome arms through Aurora B activation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19919826 2010 The p150 subunit of CAF-1 causes association of SUMO2/3 with the DNA replication foci.
19822659 2009 Two fundamentally distinct PCNA interaction peptides contribute to chromatin assembly factor 1 function.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19498464 2009 The HP1alpha-CAF1-SetDB1-containing complex provides H3K9me1 for Suv39-mediated K9me3 in pericentric heterochromatin.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19324875 2009 Gene-specific transcriptional activation mediated by the p150 subunit of the chromatin assembly factor 1.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18559551 2008 Pathway analysis of single-nucleotide polymorphisms potentially associated with glioblastoma multiforme susceptibility using random forests.
18270339 2008 Comprehensive analysis of DNA repair gene variants and risk of meningioma.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17452450 2007 Depletion of mammalian CCR4b deadenylase triggers elevation of the p27Kip1 mRNA level and impairs cell growth.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17099699 2006 The chromatin-remodeling enzyme ACF is an ATP-dependent DNA length sensor that regulates nucleosome spacing.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17066076 2006 Regulation of MBD1-mediated transcriptional repression by SUMO and PIAS proteins.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16826239 2006 The replication kinase Cdc7-Dbf4 promotes the interaction of the p150 subunit of chromatin assembly factor 1 with proliferating cell nuclear antigen.
16341674 2005 Transcriptome analysis of human gastric cancer.
15882967 2005 The mammalian heterochromatin protein 1 binds diverse nuclear proteins through a common motif that targets the chromoshadow domain.
15805117 2005 Proliferating cell nuclear antigen (PCNA) may function as a double homotrimer complex in the mammalian cell.
15664198 2005 Human Asf1 regulates the flow of S phase histones during replicational stress.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15456888 2004 The WW domain-containing proteins interact with the early spliceosome and participate in pre-mRNA splicing in vivo.
15327775 2004 Methyl-CpG binding protein MBD1 couples histone H3 methylation at lysine 9 by SETDB1 to DNA replication and chromatin assembly.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15231747 2004 A protein interaction framework for human mRNA degradation.
15067324 2004 Gene expression profiling predicts clinical outcome of prostate cancer.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14718166 2004 Histone H3.1 and H3.3 complexes mediate nucleosome assembly pathways dependent or independent of DNA synthesis.
12771185 2003 BTG2 antiproliferative protein interacts with the human CCR4 complex existing in vivo in three cell-cycle-regulated forms.
12697822 2003 The methyl-CpG binding protein MBD1 interacts with the p150 subunit of chromatin assembly factor 1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11897662 2002 Human Asf1 and CAF-1 interact and synergize in a repair-coupled nucleosome assembly pathway.
11296234 2001 Dimerization of the largest subunit of chromatin assembly factor 1: importance in vitro and during Xenopus early development.
11250073 2001 Genomic sequence and expression analyses of human chromatin assembly factor 1 p150 gene.
10938122 2000 Molecular determinants for targeting heterochromatin protein 1-mediated gene silencing: direct chromoshadow domain-KAP-1 corepressor interaction is essential.
10893180 2000 CAF-1 and the inheritance of chromatin states: at the crossroads of DNA replication and repair.
10648606 2000 A CAF-1-PCNA-mediated chromatin assembly pathway triggered by sensing DNA damage.
10549285 1999 Heterochromatin dynamics in mouse cells: interaction between chromatin assembly factor 1 and HP1 proteins.
10052459 1999 Replication-dependent marking of DNA by PCNA facilitates CAF-1-coupled inheritance of chromatin.
9614144 1998 Nucleosome assembly activity and intracellular localization of human CAF-1 changes during the cell division cycle.
8858152 1996 Nucleosome assembly by a complex of CAF-1 and acetylated histones H3/H4.
7600578 1995 The p150 and p60 subunits of chromatin assembly factor I: a molecular link between newly synthesized histones and DNA replication.